Diaphorina citri psyllid: psy15126

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300

MDLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK

ccccccccccccccccHHHHHHHHHHHHcccCEEEEEccccccccccccccccccccEEcHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccEEEHHHHHcccccccHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHcc

****DETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRE**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Delta-aminolevulinic acid dehydratase	Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.	confident	P56074
Delta-aminolevulinic acid dehydratase	Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.	confident	Q9K8G2
Delta-aminolevulinic acid dehydratase	Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.	confident	Q9PLU4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0010043 [BP]	response to zinc ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032791 [MF]	lead ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0071353 [BP]	cellular response to interleukin-4	probable	GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0007584 [BP]	response to nutrient	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0045471 [BP]	response to ethanol	probable	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.2.-.-	Carbon-oxygen lyases.	probable
4.2.1.-	Hydro-lyases.	probable
4.2.1.24	Porphobilinogen synthase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OBK, chain A
Confidence level:very confident
Coverage over the Query: 2-155,208-299
View the alignment between query and template
View the model in PyMOL

Template: 3OBK, chain A
Confidence level:very confident
Coverage over the Query: 59-107,138-192,211-299
View the alignment between query and template
View the model in PyMOL