Psyllid ID: psy15126

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MDLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK
ccccccccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEcHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccEEEHHHHHcccccccHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHcc
ccccEcccHHHHccccHHHHHHHHHHHHccccEEEEEEcccccEcccccccEcccccEcHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccccccEEEEEEEEEcccccHHHHHHHcccccccccccccEccccHHHHHHHEEcccccEcccccccEcccccEcHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccEEEEEccHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHcc
mdlrdetasfadtpdnplfqvIPMIRkqfpsltiacdvclcgytshghcaifnedgsiHYEKTLKRLADISKAFSdagahivapsdmmDNRIHAIKQSLftsrqssttgLLSYSAKFCSAfygpfreaagsaptfgdrscyqlpcgskgLAIRAAVCLcgytshghcaifnedgsiHYEKTLKRLADISKAFSdavyvpnhntdrfqardvsqgadflmvkpalpyldiisevksrhpayplfvYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK
mdlrdetasfadtpdnplfqVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTClrrggadviisyytprvlewlredk
MDLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYamlafaaqagaldlKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK
****************PLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWL****
**LRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRE**
********SFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK
****DETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRED*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLREDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
Q58DK5329 Delta-aminolevulinic acid yes N/A 0.81 0.738 0.484 2e-77
P10518330 Delta-aminolevulinic acid yes N/A 0.813 0.739 0.466 4e-77
P13716330 Delta-aminolevulinic acid yes N/A 0.813 0.739 0.469 3e-76
Q5R971330 Delta-aminolevulinic acid yes N/A 0.813 0.739 0.469 3e-76
P06214330 Delta-aminolevulinic acid yes N/A 0.813 0.739 0.456 5e-76
Q60HH9330 Delta-aminolevulinic acid N/A N/A 0.813 0.739 0.462 2e-75
Q55E06333 Delta-aminolevulinic acid yes N/A 0.806 0.726 0.418 7e-65
P78974329 Delta-aminolevulinic acid yes N/A 0.806 0.735 0.414 9e-62
O42768340 Delta-aminolevulinic acid yes N/A 0.803 0.708 0.406 9e-58
P05373342 Delta-aminolevulinic acid yes N/A 0.816 0.716 0.407 5e-56
>sp|Q58DK5|HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus GN=ALAD PE=2 SV=1 Back     alignment and function desciption
 Score =  289 bits (740), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 186/295 (63%), Gaps = 52/295 (17%)

Query: 4   RDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKT 63
           +DE  S AD+ D+P  + I ++RK FPSL +ACDVCLC YTSHGHC + +E+GS   E++
Sbjct: 87  KDERGSAADSEDSPAIEAIRLLRKNFPSLLVACDVCLCPYTSHGHCGLLSENGSFQAEES 146

Query: 64  LKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYG 123
            +RLA+++ A++ AG  +VAPSDMMD R+ AIK++L      +   ++SYSAKF S FYG
Sbjct: 147 RQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGFGNRVSVMSYSAKFASCFYG 206

Query: 124 PFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLK 183
           PFR+AA S+P FGDR CYQLP G++GLA+RA                             
Sbjct: 207 PFRDAAQSSPAFGDRRCYQLPPGARGLALRA----------------------------- 237

Query: 184 RLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLF 243
                               DR    DV +GAD LMVKP  PYLDI+ EVK++HP  PL 
Sbjct: 238 -------------------VDR----DVREGADLLMVKPGTPYLDIVREVKNKHPELPLA 274

Query: 244 VYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRE 298
           VY VSGE+AML   AQAGA DLK A++E +T  RR GADVII+YYTP++L+WL+E
Sbjct: 275 VYHVSGEFAMLWHGAQAGAFDLKAAVLEVMTAFRRAGADVIITYYTPQLLQWLKE 329
Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.
Bos taurus (taxid: 9913)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 4
>sp|P10518|HEM2_MOUSE Delta-aminolevulinic acid dehydratase OS=Mus musculus GN=Alad PE=1 SV=1 Back     alignment and function description
>sp|P13716|HEM2_HUMAN Delta-aminolevulinic acid dehydratase OS=Homo sapiens GN=ALAD PE=1 SV=1 Back     alignment and function description
>sp|Q5R971|HEM2_PONAB Delta-aminolevulinic acid dehydratase OS=Pongo abelii GN=ALAD PE=2 SV=2 Back     alignment and function description
>sp|P06214|HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus GN=Alad PE=1 SV=1 Back     alignment and function description
>sp|Q60HH9|HEM2_MACFA Delta-aminolevulinic acid dehydratase OS=Macaca fascicularis GN=ALAD PE=2 SV=2 Back     alignment and function description
>sp|Q55E06|HEM2_DICDI Delta-aminolevulinic acid dehydratase OS=Dictyostelium discoideum GN=alad PE=3 SV=2 Back     alignment and function description
>sp|P78974|HEM2_SCHPO Delta-aminolevulinic acid dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem2 PE=2 SV=2 Back     alignment and function description
>sp|O42768|HEM2_CANGA Delta-aminolevulinic acid dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM2 PE=3 SV=1 Back     alignment and function description
>sp|P05373|HEM2_YEAST Delta-aminolevulinic acid dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
156545691335 PREDICTED: delta-aminolevulinic acid deh 0.806 0.722 0.510 2e-80
387015490332 Delta-aminolevulinic acid dehydratase-li 0.82 0.740 0.506 6e-80
118403974330 aminolevulinate dehydratase [Xenopus (Si 0.813 0.739 0.503 9e-78
291243188333 PREDICTED: MGC84775 protein-like [Saccog 0.81 0.729 0.501 2e-77
126297574330 PREDICTED: delta-aminolevulinic acid deh 0.81 0.736 0.501 1e-76
170039024328 delta-aminolevulinic acid dehydratase [C 0.81 0.740 0.491 2e-76
426219671315 PREDICTED: delta-aminolevulinic acid deh 0.81 0.771 0.488 3e-76
301760045330 PREDICTED: delta-aminolevulinic acid deh 0.813 0.739 0.476 5e-76
332374414341 unknown [Dendroctonus ponderosae] 0.806 0.709 0.486 5e-76
426219669332 PREDICTED: delta-aminolevulinic acid deh 0.81 0.731 0.488 5e-76
>gi|156545691|ref|XP_001604460.1| PREDICTED: delta-aminolevulinic acid dehydratase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  305 bits (781), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/294 (51%), Positives = 185/294 (62%), Gaps = 52/294 (17%)

Query: 4   RDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKT 63
           +DE AS AD+P NP+ Q +P++R  FPSL IACDVCLC Y+SHGHC I N+DG+I  + +
Sbjct: 89  KDEIASAADSPANPIIQALPLLRNWFPSLIIACDVCLCPYSSHGHCGILNDDGTIDNKPS 148

Query: 64  LKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYG 123
           +KR+ADI+ A++ AGAHIVAPSDMMD RI AIK  L  +  S+   +LSYS KF S FYG
Sbjct: 149 IKRIADIAVAYAKAGAHIVAPSDMMDGRIKAIKHGLAAAGLSNKVAVLSYSVKFASGFYG 208

Query: 124 PFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLK 183
           PFR+A+ SAP FGDR CYQLP GS GLA RAA                            
Sbjct: 209 PFRDASKSAPKFGDRQCYQLPSGSNGLAARAA---------------------------- 240

Query: 184 RLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLF 243
                                   ARD+ +GAD LMVKP L YLDI+ E K+ HP YP+F
Sbjct: 241 ------------------------ARDIEEGADMLMVKPGLAYLDIVKETKNAHPEYPMF 276

Query: 244 VYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLR 297
           +YQVSGEYAML   AQ GA++L+  L E L C+RR GAD II+Y+TP +L+ LR
Sbjct: 277 IYQVSGEYAMLYHGAQNGAINLEAVLKEVLVCMRRAGADCIITYFTPLILDMLR 330

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|387015490|gb|AFJ49864.1| Delta-aminolevulinic acid dehydratase-like [Crotalus adamanteus] Back     alignment and taxonomy information
>gi|118403974|ref|NP_001072186.1| aminolevulinate dehydratase [Xenopus (Silurana) tropicalis] gi|111598456|gb|AAH80497.1| delta-aminolevulinic acid dehydratase [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|291243188|ref|XP_002741486.1| PREDICTED: MGC84775 protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|126297574|ref|XP_001363909.1| PREDICTED: delta-aminolevulinic acid dehydratase-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|170039024|ref|XP_001847346.1| delta-aminolevulinic acid dehydratase [Culex quinquefasciatus] gi|167862655|gb|EDS26038.1| delta-aminolevulinic acid dehydratase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|426219671|ref|XP_004004042.1| PREDICTED: delta-aminolevulinic acid dehydratase isoform 2 [Ovis aries] Back     alignment and taxonomy information
>gi|301760045|ref|XP_002915825.1| PREDICTED: delta-aminolevulinic acid dehydratase-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|332374414|gb|AEE62348.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|426219669|ref|XP_004004041.1| PREDICTED: delta-aminolevulinic acid dehydratase isoform 1 [Ovis aries] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
UNIPROTKB|Q58DK5329 ALAD "Delta-aminolevulinic aci 0.503 0.458 0.549 8.6e-71
UNIPROTKB|F1PZA0337 ALAD "Delta-aminolevulinic aci 0.503 0.448 0.536 1.8e-70
MGI|MGI:96853330 Alad "aminolevulinate, delta-, 0.503 0.457 0.536 4.7e-70
UNIPROTKB|B7Z3I9313 ALAD "Delta-aminolevulinic aci 0.503 0.482 0.529 6e-70
UNIPROTKB|P13716330 ALAD "Delta-aminolevulinic aci 0.503 0.457 0.529 6e-70
UNIPROTKB|Q5R971330 ALAD "Delta-aminolevulinic aci 0.503 0.457 0.536 9.8e-70
UNIPROTKB|F1NN39342 ALAD "Delta-aminolevulinic aci 0.503 0.441 0.582 1.6e-69
RGD|2083330 Alad "aminolevulinate dehydrat 0.503 0.457 0.529 2e-69
UNIPROTKB|Q60HH9330 ALAD "Delta-aminolevulinic aci 0.503 0.457 0.523 2.6e-69
ZFIN|ZDB-GENE-050417-123331 alad "aminolevulinate dehydrat 0.503 0.456 0.556 2.6e-69
UNIPROTKB|Q58DK5 ALAD "Delta-aminolevulinic acid dehydratase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 8.6e-71, Sum P(2) = 8.6e-71
 Identities = 83/151 (54%), Positives = 113/151 (74%)

Query:     4 RDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKT 63
             +DE  S AD+ D+P  + I ++RK FPSL +ACDVCLC YTSHGHC + +E+GS   E++
Sbjct:    87 KDERGSAADSEDSPAIEAIRLLRKNFPSLLVACDVCLCPYTSHGHCGLLSENGSFQAEES 146

Query:    64 LKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYG 123
              +RLA+++ A++ AG  +VAPSDMMD R+ AIK++L      +   ++SYSAKF S FYG
Sbjct:   147 RQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGFGNRVSVMSYSAKFASCFYG 206

Query:   124 PFREAAGSAPTFGDRSCYQLPCGSKGLAIRA 154
             PFR+AA S+P FGDR CYQLP G++GLA+RA
Sbjct:   207 PFRDAAQSSPAFGDRRCYQLPPGARGLALRA 237
GO:0008270 "zinc ion binding" evidence=ISS
GO:0004655 "porphobilinogen synthase activity" evidence=ISS
GO:0032791 "lead ion binding" evidence=ISS
GO:0006783 "heme biosynthetic process" evidence=ISS
GO:0006782 "protoporphyrinogen IX biosynthetic process" evidence=IEA
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0042802 "identical protein binding" evidence=IEA
UNIPROTKB|F1PZA0 ALAD "Delta-aminolevulinic acid dehydratase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:96853 Alad "aminolevulinate, delta-, dehydratase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z3I9 ALAD "Delta-aminolevulinic acid dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P13716 ALAD "Delta-aminolevulinic acid dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R971 ALAD "Delta-aminolevulinic acid dehydratase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN39 ALAD "Delta-aminolevulinic acid dehydratase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2083 Alad "aminolevulinate dehydratase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q60HH9 ALAD "Delta-aminolevulinic acid dehydratase" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-123 alad "aminolevulinate dehydratase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P56074HEM2_HELPY4, ., 2, ., 1, ., 2, 40.34450.80330.7461yesN/A
Q9K8G2HEM2_BACHD4, ., 2, ., 1, ., 2, 40.37010.75330.6890yesN/A
Q9PLU4HEM2_CHLMU4, ., 2, ., 1, ., 2, 40.34000.80.7207yesN/A
P43087HEM2_SYNE74, ., 2, ., 1, ., 2, 40.34180.72660.6687yesN/A
Q750E0HEM2_ASHGO4, ., 2, ., 1, ., 2, 40.53190.470.4147yesN/A
Q55E06HEM2_DICDI4, ., 2, ., 1, ., 2, 40.41890.80660.7267yesN/A
P0C1R9HEM2_STAAU4, ., 2, ., 1, ., 2, 40.32980.76660.7120yesN/A
P78974HEM2_SCHPO4, ., 2, ., 1, ., 2, 40.41490.80660.7355yesN/A
Q5HNN5HEM2_STAEQ4, ., 2, ., 1, ., 2, 40.32150.75660.7006yesN/A
P45622HEM2_BRAJA4, ., 2, ., 1, ., 2, 40.38510.80.6798yesN/A
O84638HEM2_CHLTR4, ., 2, ., 1, ., 2, 40.32990.80.7100yesN/A
O28305HEM2_ARCFU4, ., 2, ., 1, ., 2, 40.36050.79330.7391yesN/A
P10518HEM2_MOUSE4, ., 2, ., 1, ., 2, 40.46620.81330.7393yesN/A
P42504HEM2_RHOCA4, ., 2, ., 1, ., 2, 40.32870.77660.7018yesN/A
P06214HEM2_RAT4, ., 2, ., 1, ., 2, 40.45600.81330.7393yesN/A
O33357HEM2_MYCTU4, ., 2, ., 1, ., 2, 40.31970.79330.7234yesN/A
Q5HFA4HEM2_STAAC4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
P13716HEM2_HUMAN4, ., 2, ., 1, ., 2, 40.46950.81330.7393yesN/A
P30950HEM2_BACSU4, ., 2, ., 1, ., 2, 40.35120.74660.6913yesN/A
Q8KCJ0HEM2_CHLTE4, ., 2, ., 1, ., 2, 40.35710.79660.7286yesN/A
P54919HEM2_STRCO4, ., 2, ., 1, ., 2, 40.33220.79660.7242yesN/A
Q59643HEM2_PSEAE4, ., 2, ., 1, ., 2, 40.34890.73660.6557yesN/A
Q60178HEM2_METJA4, ., 2, ., 1, ., 2, 40.38690.78660.7044yesN/A
O67876HEM2_AQUAE4, ., 2, ., 1, ., 2, 40.33910.76330.6939yesN/A
Q9ZMR8HEM2_HELPJ4, ., 2, ., 1, ., 2, 40.34450.80330.7461yesN/A
Q8CNZ0HEM2_STAES4, ., 2, ., 1, ., 2, 40.32150.75660.7006yesN/A
P64335HEM2_STAAW4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
O42768HEM2_CANGA4, ., 2, ., 1, ., 2, 40.40610.80330.7088yesN/A
Q58DK5HEM2_BOVIN4, ., 2, ., 1, ., 2, 40.48470.810.7386yesN/A
Q59334HEM2_CHLP84, ., 2, ., 1, ., 2, 40.35710.79660.7286yesN/A
P64333HEM2_STAAM4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
Q6G8Q7HEM2_STAAS4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
Q5R971HEM2_PONAB4, ., 2, ., 1, ., 2, 40.46950.81330.7393yesN/A
P64334HEM2_STAAN4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
P05373HEM2_YEAST4, ., 2, ., 1, ., 2, 40.40740.81660.7163yesN/A
Q2FXR3HEM2_STAA84, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A
P0ACB3HEM2_SHIFL4, ., 2, ., 1, ., 2, 40.36610.760.7037yesN/A
O26839HEM2_METTH4, ., 2, ., 1, ., 2, 40.37580.77660.7147yesN/A
Q6GG37HEM2_STAAR4, ., 2, ., 1, ., 2, 40.32310.79660.7376yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.10.766
4th Layer4.2.1.240.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
cd04824320 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinog 1e-126
smart01004321 smart01004, ALAD, Delta-aminolevulinic acid dehydr 1e-120
pfam00490322 pfam00490, ALAD, Delta-aminolevulinic acid dehydra 1e-118
COG0113330 COG0113, HemB, Delta-aminolevulinic acid dehydrata 1e-109
cd00384314 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS 1e-105
PRK09283323 PRK09283, PRK09283, delta-aminolevulinic acid dehy 2e-57
PRK09283323 PRK09283, PRK09283, delta-aminolevulinic acid dehy 1e-44
cd04823320 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen 2e-43
cd04823320 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen 8e-40
PRK13384322 PRK13384, PRK13384, delta-aminolevulinic acid dehy 6e-31
PRK13384322 PRK13384, PRK13384, delta-aminolevulinic acid dehy 5e-28
PRK09283323 PRK09283, PRK09283, delta-aminolevulinic acid dehy 6e-06
>gnl|CDD|240128 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information 
 Score =  362 bits (930), Expect = e-126
 Identities = 147/292 (50%), Positives = 185/292 (63%), Gaps = 52/292 (17%)

Query: 5   DETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTL 64
           D + S AD  D P+ Q I +IR++FP L IACDVCLC YTSHGHC I  EDG+I+ E ++
Sbjct: 81  DRSGSAADDEDGPVIQAIKLIREEFPELLIACDVCLCEYTSHGHCGILYEDGTINNEASV 140

Query: 65  KRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGP 124
           KRLA+++ A++ AGAHIVAPSDMMD R+ AIKQ+L  +   +   ++SYSAKF S  YGP
Sbjct: 141 KRLAEVALAYAKAGAHIVAPSDMMDGRVRAIKQALIQAGLGNKVSVMSYSAKFASCLYGP 200

Query: 125 FREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLKR 184
           FR+AA SAP+FGDR CYQLP G++GLA+RA                              
Sbjct: 201 FRDAACSAPSFGDRRCYQLPPGARGLALRAVE---------------------------- 232

Query: 185 LADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFV 244
                                   RDVS+GAD +MVKP  PYLDI+ E K +HP  PL V
Sbjct: 233 ------------------------RDVSEGADMIMVKPGTPYLDIVREAKDKHPDLPLAV 268

Query: 245 YQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWL 296
           Y VSGEYAML  AA+AGA DLKRA++E +T  RR GAD+II+Y+TP +L+WL
Sbjct: 269 YHVSGEYAMLHAAAEAGAFDLKRAVLEAMTGFRRAGADIIITYFTPELLDWL 320

This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. The eukaryotic PBGSs represented by this model, which contain a cysteine-rich zinc binding motif (DXCXCX(Y/F)X3G(H/Q)CG), require zinc for their activity, they do not contain an additional allosteric metal binding site and do not bind magnesium. Length = 320
>gnl|CDD|214968 smart01004, ALAD, Delta-aminolevulinic acid dehydratase Back     alignment and domain information
>gnl|CDD|215945 pfam00490, ALAD, Delta-aminolevulinic acid dehydratase Back     alignment and domain information
>gnl|CDD|223191 COG0113, HemB, Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238226 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|236450 PRK09283, PRK09283, delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>gnl|CDD|236450 PRK09283, PRK09283, delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>gnl|CDD|240127 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|240127 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|172020 PRK13384, PRK13384, delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|172020 PRK13384, PRK13384, delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236450 PRK09283, PRK09283, delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 100.0
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 100.0
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 100.0
COG0113330 HemB Delta-aminolevulinic acid dehydratase [Coenzy 100.0
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 100.0
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 100.0
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 100.0
KOG2794|consensus340 100.0
COG0113330 HemB Delta-aminolevulinic acid dehydratase [Coenzy 100.0
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 100.0
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 100.0
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 100.0
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 100.0
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 100.0
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 100.0
KOG2794|consensus340 100.0
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 96.6
cd08148366 RuBisCO_large Ribulose bisphosphate carboxylase la 96.4
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 96.38
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 95.99
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 95.99
cd08209391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 95.85
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 95.61
PRK04208 468 rbcL ribulose bisophosphate carboxylase; Reviewed 95.58
cd08206 414 RuBisCO_large_I_II_III Ribulose bisphosphate carbo 95.58
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 95.49
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.33
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.32
cd08213 412 RuBisCO_large_III Ribulose bisphosphate carboxylas 95.07
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 95.05
PRK09549407 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate eno 95.02
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.78
TIGR03332407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosp 94.49
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.1
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.06
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 93.84
PF00016 309 RuBisCO_large: Ribulose bisphosphate carboxylase l 93.03
cd08212 450 RuBisCO_large_I Ribulose bisphosphate carboxylase 92.81
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 92.81
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.75
CHL00040 475 rbcL ribulose-1,5-bisphosphate carboxylase/oxygena 92.65
cd08208424 RLP_Photo Ribulose bisphosphate carboxylase like p 92.53
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 92.44
TIGR03249 296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 92.15
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 92.08
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 91.9
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 91.72
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 91.55
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 91.29
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 91.08
PF00701 289 DHDPS: Dihydrodipicolinate synthetase family; Inte 90.93
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 90.8
PRK07534336 methionine synthase I; Validated 90.61
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 90.42
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 90.37
PRK04147 293 N-acetylneuraminate lyase; Provisional 90.19
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 89.98
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 89.79
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 89.77
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 89.75
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 89.74
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 89.27
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 89.26
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.66
cd08211 439 RuBisCO_large_II Ribulose bisphosphate carboxylase 88.66
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 88.62
PLN02417 280 dihydrodipicolinate synthase 88.35
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 87.96
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 87.74
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.55
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 87.53
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 87.48
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 87.03
PF00072112 Response_reg: Response regulator receiver domain; 86.56
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 86.32
PRK12999 1146 pyruvate carboxylase; Reviewed 86.26
PRK15063428 isocitrate lyase; Provisional 85.98
cd00423258 Pterin_binding Pterin binding enzymes. This family 85.87
PLN02274 505 inosine-5'-monophosphate dehydrogenase 85.64
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 85.53
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 85.24
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 85.17
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 84.9
PRK03170 292 dihydrodipicolinate synthase; Provisional 84.88
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 84.15
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 84.0
PF02548 261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 83.81
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 83.77
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 82.63
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 82.51
PRK08645 612 bifunctional homocysteine S-methyltransferase/5,10 82.44
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 82.08
PRK13475 443 ribulose bisphosphate carboxylase; Provisional 81.35
cd00945 201 Aldolase_Class_I Class I aldolases. The class I al 80.73
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 80.6
PRK08444 353 hypothetical protein; Provisional 80.47
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 80.38
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 80.37
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 80.31
COG0413 268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 80.18
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information 
Probab=100.00  E-value=9.4e-106  Score=756.03  Aligned_cols=243  Identities=60%  Similarity=1.063  Sum_probs=239.1

Q ss_pred             CCCCcc-cccCCCCCChHHHHHHHHHHhCCCcEEEeeecCCCCCCCCcceeeCCCCceecHHhHHHHHHHHHHHHHcCCC
Q psy15126          2 DLRDET-ASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAH   80 (300)
Q Consensus         2 ~~kd~~-~s~a~~~~~~~~~~i~~ik~~~p~l~i~~Dvclc~yt~hGHcgi~~~~g~i~nd~Tl~~l~~~A~~~A~aGad   80 (300)
                      +.||+. ||+||+|||++||+||.||++||+++|||||||||||+||||||++++|.|+||+||++|++||+++|+||||
T Consensus        77 ~~Kd~~~gs~a~~~~g~v~~air~iK~~~pdl~vi~Dvclc~YT~hGHcGil~~~g~vdND~Tl~~L~k~Avs~A~AGAD  156 (320)
T cd04824          77 PGKDDRSGSAADDEDGPVIQAIKLIREEFPELLIACDVCLCEYTSHGHCGILYEDGTINNEASVKRLAEVALAYAKAGAH  156 (320)
T ss_pred             ccCCcCccccccCCCChHHHHHHHHHHhCCCcEEEEeeeccCCCCCCcceeECCCCcCcCHHHHHHHHHHHHHHHHhCCC
Confidence            359999 9999999999999999999999999999999999999999999998789999999999999999999999999


Q ss_pred             ccccCCCCcchHHHHHHHHhhCCCCCCcccccchhhhhcccchhhhhhhcCCCCCCCcceeeCCCCCCceEEEEeecccC
Q psy15126         81 IVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCG  160 (300)
Q Consensus        81 ~vAPSdmMDgrv~air~aLd~~g~~~~v~ImsysaK~aS~~YGPfRda~gS~~~~gdr~~yQ~~~~~~~~ai~~dvclc~  160 (300)
                      +|||||||||||++||++||.+||+.+|+|||||+||||+||||||||++|+|+||||++|||||+|.++|+|+.     
T Consensus       157 iVAPSdMMDGrV~aIR~aLD~~G~~~~v~ImSYsaKyaS~fYGPFRdAa~Sap~~gDRksYQmdp~n~~eAlre~-----  231 (320)
T cd04824         157 IVAPSDMMDGRVRAIKQALIQAGLGNKVSVMSYSAKFASCLYGPFRDAACSAPSFGDRRCYQLPPGARGLALRAV-----  231 (320)
T ss_pred             EEecccccccHHHHHHHHHHHCCCccCCeeeehHHHhhhhccchHHHHhcCCCCCCCccccCCCCcCHHHHHHHH-----
Confidence            999999999999999999999999779999999999999999999999999999999999999999999999997     


Q ss_pred             CCCCCccccccCCCcccchHhHHHHHHHHHhhhcccccCCCCCccccchhhhcCCceeeccCcchHHHHHHHHHhhCCCC
Q psy15126        161 YTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAY  240 (300)
Q Consensus       161 yt~hGHcgi~~~~g~i~nd~tl~~l~~~a~~~a~~~~~~~~n~~~~~~~Da~~GADivmVkPsmm~ld~Ir~~~d~~~~v  240 (300)
                                                                     ++|++||||||||||+++|||+||++|++||++
T Consensus       232 -----------------------------------------------~~D~~EGAD~lMVKPal~YLDIi~~~k~~~~~~  264 (320)
T cd04824         232 -----------------------------------------------ERDVSEGADMIMVKPGTPYLDIVREAKDKHPDL  264 (320)
T ss_pred             -----------------------------------------------HhhHHhCCCEEEEcCCchHHHHHHHHHHhccCC
Confidence                                                           899999999999999999999999999999999


Q ss_pred             CEEeEecccccHHHHHHHhCCCCCHHHHHHHHHHHHHHcCCCEEEecchHHHHHHH
Q psy15126        241 PLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWL  296 (300)
Q Consensus       241 pi~aY~vSgeY~~~r~Aa~~~~~n~~eal~E~~~~~~r~GAD~Ii~y~A~~~ld~l  296 (300)
                      ||.+|||||||+|+|+|+++||+|++++++|+|++|||+|||+||||||+++++||
T Consensus       265 PvaaYqVSGEYaMikaAa~~G~iDe~~~~~Esl~~ikRAGAd~IiTYfA~~~a~wL  320 (320)
T cd04824         265 PLAVYHVSGEYAMLHAAAEAGAFDLKRAVLEAMTGFRRAGADIIITYFTPELLDWL  320 (320)
T ss_pred             CEEEEEccHHHHHHHHHHHcCCCcHHHHHHHHHHHHHhcCCCEEEeecHHHHHhhC
Confidence            99999999999999999999999999999999999999999999999999999997

This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. The eukaryotic PBGSs represented by this model, which contain a cysteine-rich zinc binding motif (DXCXCX(Y/F)X3G(H/Q)CG), require zinc for their activity, they
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>KOG2794|consensus Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>KOG2794|consensus Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd08148 RuBisCO_large Ribulose bisphosphate carboxylase large chain Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>cd08206 RuBisCO_large_I_II_III Ribulose bisphosphate carboxylase large chain, Form I,II,III Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd08213 RuBisCO_large_III Ribulose bisphosphate carboxylase large chain, Form III Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF00016 RuBisCO_large: Ribulose bisphosphate carboxylase large chain, catalytic domain; InterPro: IPR000685 Ribulose bisphosphate carboxylase (RuBisCO) [, ] catalyses the initial step in Calvin's reductive pentose phosphate cycle in plants as well as purple and green bacteria Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>cd08208 RLP_Photo Ribulose bisphosphate carboxylase like proteins from phototrophic bacteria Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK07534 methionine synthase I; Validated Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd08211 RuBisCO_large_II Ribulose bisphosphate carboxylase large chain, Form II Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK13475 ribulose bisphosphate carboxylase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2z1b_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 1e-71
1pv8_A330 Crystal Structure Of A Low Activity F12l Mutant Of 1e-70
1e51_A330 Crystal Structure Of Native Human Erythrocyte 5- Am 1e-70
2z0i_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 1e-67
1ylv_A342 Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid 2e-52
1qnv_A342 Yeast 5-Aminolaevulinic Acid Dehydratase Lead (Pb) 2e-51
1h7o_A341 Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid 2e-51
1eb3_A340 Yeast 5-Aminolaevulinic Acid Dehydratase 4,7-Dioxos 3e-51
1aw5_A340 5-Aminolevulinate Dehydratase From Saccharomyces Ce 1e-49
1w5q_A337 Stepwise Introduction Of Zinc Binding Site Into Por 6e-41
1w5p_A337 Stepwise Introduction Of Zinc Binding Site Into Por 2e-40
1w5o_A337 Stepwise Introduction Of Zinc Binding Site Into Por 2e-40
1w5n_A337 Stepwise Introduction Of Zinc Binding Site Into Por 1e-39
1w56_A337 Stepwise Introduction Of Zinc Binding Site Into Por 4e-39
1w5m_A337 Stepwise Introduction Of Zinc Binding Site Into Por 4e-39
1w1z_A328 Structure Of The Plant Like 5-Amino Laevulinic Acid 5e-39
1w54_A337 Stepwise Introduction Of A Zinc Binding Site Into P 2e-38
1gzg_A337 Complex Of A Mg2-Dependent Porphobilinogen Synthase 3e-37
1b4k_A337 High Resolution Crystal Structure Of A Mg2-Dependen 3e-37
2c15_A337 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Aci 2e-36
1b4e_A323 X-Ray Structure Of 5-Aminolevulinic Acid Dehydratas 5e-35
1l6s_A323 Crystal Structure Of Porphobilinogen Synthase Compl 7e-35
1i8j_A323 Crystal Structure Of Porphobilinogen Synthase Compl 2e-34
2c14_A337 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid 3e-31
2c13_A337 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen S 2e-30
3obk_A356 Crystal Structure Of Delta-Aminolevulinic Acid Dehy 2e-18
3obk_A356 Crystal Structure Of Delta-Aminolevulinic Acid Dehy 7e-14
>pdb|2Z1B|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs Length = 330 Back     alignment and structure 
Iteration: 1

 Score =  266 bits (680), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 177/296 (59%), Gaps = 52/296 (17%)
Query: 4   RDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKT 63
           +DE  S AD+ D+P  + + ++RK FPSL +ACDVCLC YTSHGHC + +E+G+   E++
Sbjct: 87  KDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLSEES 146
Query: 64  LKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAFYG 123
            +RLA+++ A++ AG  +VAPSDMMD R+ AIK +L      +   ++SYSAKF S FYG
Sbjct: 147 RQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYG 206
Query: 124 PFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKTLK 183
           PFR+AA S+P FGDR CYQLP G++GLA+RA                             
Sbjct: 207 PFRDAAQSSPAFGDRRCYQLPPGARGLALRAV---------------------------- 238
Query: 184 RLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLF 243
                                   ARD+ +GAD LMVKP LPYLD++ EVK +HP  PL 
Sbjct: 239 ------------------------ARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLA 274
Query: 244 VYQVSGEYXXXXXXXXXXXXXXKRALMETLTCLRRGGADVIISYYTPRVLEWLRED 299
           VYQVSGE+              + A++ET+T  RR GAD+II+Y+ P++L+WL+E+
Sbjct: 275 VYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLKEE 330
>pdb|1PV8|A Chain A, Crystal Structure Of A Low Activity F12l Mutant Of Human Porphobilinogen Synthase Length = 330 Back     alignment and structure
>pdb|1E51|A Chain A, Crystal Structure Of Native Human Erythrocyte 5- Aminolaevulinic Acid Dehydratase Length = 330 Back     alignment and structure
>pdb|2Z0I|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculus Length = 330 Back     alignment and structure
>pdb|1YLV|A Chain A, Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid Dehydratase With Laevulinic Acid Length = 342 Back     alignment and structure
>pdb|1QNV|A Chain A, Yeast 5-Aminolaevulinic Acid Dehydratase Lead (Pb) Complex Length = 342 Back     alignment and structure
>pdb|1H7O|A Chain A, Schiff-Base Complex Of Yeast 5-Aminolaevulinic Acid Dehydratase With 5-Aminolaevulinic Acid At 1.7 A Resolution Length = 341 Back     alignment and structure
>pdb|1EB3|A Chain A, Yeast 5-Aminolaevulinic Acid Dehydratase 4,7-Dioxosebacic Acid Complex Length = 340 Back     alignment and structure
>pdb|1AW5|A Chain A, 5-Aminolevulinate Dehydratase From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|1W5Q|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e, K229r) Length = 337 Back     alignment and structure
>pdb|1W5P|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e) Length = 337 Back     alignment and structure
>pdb|1W5O|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c And D139c) Length = 337 Back     alignment and structure
>pdb|1W5N|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations D131c And D139c) Length = 337 Back     alignment and structure
>pdb|1W56|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D131c) Length = 337 Back     alignment and structure
>pdb|1W5M|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D139c) Length = 337 Back     alignment and structure
>pdb|1W1Z|A Chain A, Structure Of The Plant Like 5-Amino Laevulinic Acid Dehydratase From Chlorobium Vibrioforme Length = 328 Back     alignment and structure
>pdb|1W54|A Chain A, Stepwise Introduction Of A Zinc Binding Site Into Porphobilinogen Synthase From Pseudomonas Aeruginosa (mutation D139c) Length = 337 Back     alignment and structure
>pdb|1GZG|A Chain A, Complex Of A Mg2-Dependent Porphobilinogen Synthase From Pseudomonas Aeruginosa (Mutant D139n) With 5-Fluorolevulinic Acid Length = 337 Back     alignment and structure
>pdb|1B4K|A Chain A, High Resolution Crystal Structure Of A Mg2-Dependent 5-Aminolevulinic Acid Dehydratase Length = 337 Back     alignment and structure
>pdb|2C15|A Chain A, 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|1B4E|A Chain A, X-Ray Structure Of 5-Aminolevulinic Acid Dehydratase Complexed With The Inhibitor Levulinic Acid Length = 323 Back     alignment and structure
>pdb|1L6S|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>pdb|1I8J|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>pdb|2C14|A Chain A, 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|2C13|A Chain A, 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|3OBK|A Chain A, Crystal Structure Of Delta-Aminolevulinic Acid Dehydratase (Porphobilinogen Synthase) From Toxoplasma Gondii Me49 In Complex With The Reaction Product Porphobilinogen Length = 356 Back     alignment and structure
>pdb|3OBK|A Chain A, Crystal Structure Of Delta-Aminolevulinic Acid Dehydratase (Porphobilinogen Synthase) From Toxoplasma Gondii Me49 In Complex With The Reaction Product Porphobilinogen Length = 356 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 1e-124
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 1e-123
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 4e-54
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 5e-42
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 6e-05
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 9e-54
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 3e-41
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 2e-06
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 4e-52
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 6e-41
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 4e-05
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 1e-51
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 2e-43
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 9e-04
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Length = 330 Back     alignment and structure
 Score =  357 bits (918), Expect = e-124
 Identities = 138/298 (46%), Positives = 186/298 (62%), Gaps = 52/298 (17%)

Query: 2   DLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYE 61
             +DE  S AD+ ++P  + I ++RK FP+L +ACDVCLC YTSHGHC + +E+G+   E
Sbjct: 85  VPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAE 144

Query: 62  KTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSAF 121
           ++ +RLA+++ A++ AG  +VAPSDMMD R+ AIK++L      +   ++SYSAKF S F
Sbjct: 145 ESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCF 204

Query: 122 YGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEKT 181
           YGPFR+AA S+P FGDR CYQLP G++GLA+RA                           
Sbjct: 205 YGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAV-------------------------- 238

Query: 182 LKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYP 241
                                      RDV +GAD LMVKP +PYLDI+ EVK +HP  P
Sbjct: 239 --------------------------DRDVREGADMLMVKPGMPYLDIVREVKDKHPDLP 272

Query: 242 LFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRED 299
           L VY VSGE+AML   AQAGA DLK A++E +T  RR GAD+II+YYTP++L+WL+E+
Sbjct: 273 LAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE 330
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Length = 328 Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Length = 328 Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Length = 328 Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Length = 337 Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Length = 337 Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Length = 337 Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Length = 323 Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Length = 323 Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Length = 323 Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Length = 356 Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Length = 356 Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Length = 356 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 100.0
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 100.0
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 100.0
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 100.0
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 100.0
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 100.0
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 100.0
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 100.0
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 100.0
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 100.0
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 100.0
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 100.0
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 95.67
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 95.38
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 94.46
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 93.99
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 93.98
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.84
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 93.44
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 93.18
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 92.56
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 92.48
3nav_A 271 Tryptophan synthase alpha chain; alpha subunit, st 92.39
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 92.38
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 91.7
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.68
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 91.52
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 91.43
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 91.33
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 91.32
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 91.07
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 90.96
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 90.95
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 90.95
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 90.91
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 90.81
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 90.81
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 90.64
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 90.43
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 90.31
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 90.17
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 90.04
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 90.04
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 89.91
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 89.5
3eol_A433 Isocitrate lyase; seattle structural center for in 89.45
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 89.33
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 89.01
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 88.98
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 88.98
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 88.82
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 88.74
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 88.53
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 88.36
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 88.26
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 88.23
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 88.02
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.81
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 87.8
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 87.6
3vnd_A 267 TSA, tryptophan synthase alpha chain; psychrophili 87.33
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 87.23
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 87.11
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 87.04
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 86.98
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 86.87
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 86.82
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 86.65
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 86.62
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 86.57
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 86.46
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 86.39
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 86.27
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 86.06
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 85.97
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 85.92
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 85.65
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 85.5
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 85.43
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 85.34
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 85.28
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 85.27
3f6c_A134 Positive transcription regulator EVGA; structural 85.19
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 84.92
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 84.72
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 84.71
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 84.71
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 84.54
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 84.4
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 84.31
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 84.28
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 84.07
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 84.03
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 84.02
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 83.61
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 83.41
3jte_A143 Response regulator receiver protein; structural ge 83.38
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 83.01
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 82.86
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 82.86
3eul_A152 Possible nitrate/nitrite response transcriptional 82.74
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 82.62
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 82.58
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 82.46
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 82.34
3eqz_A135 Response regulator; structural genomics, unknown f 82.22
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 82.19
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 82.1
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 81.73
3hdg_A137 Uncharacterized protein; two-component sensor acti 81.58
3lua_A140 Response regulator receiver protein; two-component 81.45
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 80.54
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 80.4
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 80.37
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 80.19
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 80.02
2qr3_A140 Two-component system response regulator; structura 80.02
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d1pv8a_320 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 3e-68
d2c1ha1319 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase 7e-67
d1h7na_340 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 1e-65
d1gzga_329 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 5e-65
d1l6sa_323 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 6e-61
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  213 bits (543), Expect = 3e-68
 Identities = 138/299 (46%), Positives = 186/299 (62%), Gaps = 52/299 (17%)

Query: 1   MDLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHY 60
              +DE  S AD+ ++P  + I ++RK FP+L +ACDVCLC YTSHGHC + +E+G+   
Sbjct: 74  RVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRA 133

Query: 61  EKTLKRLADISKAFSDAGAHIVAPSDMMDNRIHAIKQSLFTSRQSSTTGLLSYSAKFCSA 120
           E++ +RLA+++ A++ AG  +VAPSDMMD R+ AIK++L      +   ++SYSAKF S 
Sbjct: 134 EESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASC 193

Query: 121 FYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCGYTSHGHCAIFNEDGSIHYEK 180
           FYGPFR+AA S+P FGDR CYQLP G++GLA+RA                          
Sbjct: 194 FYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAV------------------------- 228

Query: 181 TLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAY 240
                                       RDV +GAD LMVKP +PYLDI+ EVK +HP  
Sbjct: 229 ---------------------------DRDVREGADMLMVKPGMPYLDIVREVKDKHPDL 261

Query: 241 PLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRED 299
           PL VY VSGE+AML   AQAGA DLK A++E +T  RR GAD+II+YYTP++L+WL+E+
Sbjct: 262 PLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE 320
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Length = 319 Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 340 Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Length = 329 Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1geha1 307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 95.66
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 95.58
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 95.15
d1wdda1 325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 94.0
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 93.69
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 93.42
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 92.43
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 92.09
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 92.0
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 91.0
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 90.38
d1bwva1328 Ribulose 1,5-bisphosphate carboxylase-oxygenase {G 87.29
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 86.92
d1oy0a_ 262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 86.77
d3bofa2300 Cobalamin-dependent methionine synthase MetH, N-te 86.58
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 86.31
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 85.94
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 85.29
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 84.82
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 84.55
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 84.37
d5ruba1320 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 84.15
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 83.66
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 82.76
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 82.3
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 81.32
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 81.17
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 81.1
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 81.09
d1o66a_ 260 Ketopantoate hydroxymethyltransferase PanB {Neisse 81.08
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 80.31
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-103  Score=739.91  Aligned_cols=245  Identities=56%  Similarity=1.040  Sum_probs=199.7

Q ss_pred             CCCCcccccCCCCCChHHHHHHHHHHhCCCcEEEeeecCCCCCCCCcceeeCCCCceecHHhHHHHHHHHHHHHHcCCCc
Q psy15126          2 DLRDETASFADTPDNPLFQVIPMIRKQFPSLTIACDVCLCGYTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAGAHI   81 (300)
Q Consensus         2 ~~kd~~~s~a~~~~~~~~~~i~~ik~~~p~l~i~~Dvclc~yt~hGHcgi~~~~g~i~nd~Tl~~l~~~A~~~A~aGad~   81 (300)
                      .+||+.||+|++|+|++|||||.||++||+++|||||||||||+||||||++++|+|+||+|++.|++||+++|+||||+
T Consensus        75 ~~Kd~~gseA~n~~~lv~rair~iK~~fpdl~vi~DVcLc~YT~hGHcGil~~~~~IdND~Tl~~L~k~Al~~A~AGaDi  154 (320)
T d1pv8a_          75 VPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQV  154 (320)
T ss_dssp             ------------CCSHHHHHHHHHHHHSTTSEEEEEECCC---------------CHHHHHHHHHHHHHHHHHHHHTCSE
T ss_pred             cccCCCChhhhhhhhhHHHHHHHHHHHhhcceEeecccccccccccccceeecccccCcHHHHHHHHHHHHHHHhcccce
Confidence            36999999999999999999999999999999999999999999999999988899999999999999999999999999


Q ss_pred             cccCCCCcchHHHHHHHHhhCCCCCC-cccccchhhhhcccchhhhhhhcCCCCCCCcceeeCCCCCCceEEEEeecccC
Q psy15126         82 VAPSDMMDNRIHAIKQSLFTSRQSST-TGLLSYSAKFCSAFYGPFREAAGSAPTFGDRSCYQLPCGSKGLAIRAAVCLCG  160 (300)
Q Consensus        82 vAPSdmMDgrv~air~aLd~~g~~~~-v~ImsysaK~aS~~YGPfRda~gS~~~~gdr~~yQ~~~~~~~~ai~~dvclc~  160 (300)
                      |||||||||||++||++||++|| .+ |+|||||+||+|+||||||||++|+|.||||++|||+|+|+++|+++.     
T Consensus       155 VAPSdMMDGrV~aIR~~Ld~~g~-~~~v~ImSYsaKyaS~fYGPFRdA~~s~p~~gdr~tYQmd~~n~~eA~~e~-----  228 (320)
T d1pv8a_         155 VAPSDMMDGRVEAIKEALMAHGL-GNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAV-----  228 (320)
T ss_dssp             EEECC--CCHHHHHHHHHHHTTC-TTTCEEBCCCEECCCGGGHHHHHCC-------------CCTTCHHHHHHHH-----
T ss_pred             eeecccchHHHHHHHHHHHhcCC-cccceeechhhhcCchhhhhhHHHHhcCccCCCcceeeeCcchhHHHHHHH-----
Confidence            99999999999999999999999 56 799999999999999999999999999999999999999999999997     


Q ss_pred             CCCCCccccccCCCcccchHhHHHHHHHHHhhhcccccCCCCCccccchhhhcCCceeeccCcchHHHHHHHHHhhCCCC
Q psy15126        161 YTSHGHCAIFNEDGSIHYEKTLKRLADISKAFSDAVYVPNHNTDRFQARDVSQGADFLMVKPALPYLDIISEVKSRHPAY  240 (300)
Q Consensus       161 yt~hGHcgi~~~~g~i~nd~tl~~l~~~a~~~a~~~~~~~~n~~~~~~~Da~~GADivmVkPsmm~ld~Ir~~~d~~~~v  240 (300)
                                                                     .+|++||||||||||+|+|||+||++|++|+++
T Consensus       229 -----------------------------------------------~~D~~EGAD~lMVKPa~~yLDiI~~~k~~~~~~  261 (320)
T d1pv8a_         229 -----------------------------------------------DRDVREGADMLMVKPGMPYLDIVREVKDKHPDL  261 (320)
T ss_dssp             -----------------------------------------------HHHHHTTCSBEEEESCGGGHHHHHHHHHHSTTS
T ss_pred             -----------------------------------------------HHHHhcCCceEeeehhHHHHHHHHHHHhhCCCC
Confidence                                                           899999999999999999999999999999999


Q ss_pred             CEEeEecccccHHHHHHHhCCCCCHHHHHHHHHHHHHHcCCCEEEecchHHHHHHHhhC
Q psy15126        241 PLFVYQVSGEYAMLAFAAQAGALDLKRALMETLTCLRRGGADVIISYYTPRVLEWLRED  299 (300)
Q Consensus       241 pi~aY~vSgeY~~~r~Aa~~~~~n~~eal~E~~~~~~r~GAD~Ii~y~A~~~ld~l~~~  299 (300)
                      ||++|||||||+|+++|+++||+|++++++|+++++||+|||+||||||+++++||+++
T Consensus       262 Pv~aYqVSGEYami~aa~~~g~~d~~~~~~E~l~~~kRAGAd~IitY~A~~~a~~L~~~  320 (320)
T d1pv8a_         262 PLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE  320 (320)
T ss_dssp             CEEEEECHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHTCSEEEETTHHHHHHHTTTC
T ss_pred             CEEEEEccHHHHHHHHHHHCCCCchHHHHHHHHHHHHhcCCCEEEEhhHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999874
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bwva1 c.1.14.1 (A:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5ruba1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure