Diaphorina citri psyllid: psy15147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MSPQQTHQYTSPSEEIVKYASTGGLPGGPSIDIPSPERPPLRHIDKYVRPEIPCLSKRYTMATLTCVGFIISFGMKCNLGFAKLQFEGRFPRRQQMEPRN
cccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcEEEEEccEEcccEEEEEccccccccccccccc
******************************************HIDKYVRPEIPCLSKRYTMATLTCVGFIISFGMKCNLGFAKLQFEG************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPQQTHQYTSPSEEIVKYASTGGLPGGPSIDIPSPERPPLRHIDKYVRPEIPCLSKRYTMATLTCVGFIISFGMKCNLGFAKLQFEGRFPRRQQMEPRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted