Diaphorina citri psyllid: psy15153

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MWLTTNEASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFIASKEEMWLTTNEASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFYCFPFSTKFSVRFPPGADFIRKG
cccccHHHHcccHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
*******ASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFIASKEEMWLTTNEASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFYCFPFSTKFSVRFPPGADFIRK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLTTNEASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFIASKEEMWLTTNEASLMGAEEVAARLRVDCRSGLWWKEAELRRQLIGYNEFCVKEEDPLWRKYIEQVRKSVFLLFFYCFPFSTKFSVRFPPGADFIRKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AR4, chain A
Confidence level:very confident
Coverage over the Query: 81-158
View the alignment between query and template
View the model in PyMOL
Template: 3AR4, chain A
Confidence level:very confident
Coverage over the Query: 5-73
View the alignment between query and template
View the model in PyMOL