Diaphorina citri psyllid: psy15157


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MSEQNEQKSSAEVLRRQEALYRLIISQLYYDGHHPMAITLQSSCNVVEPCPPSDRLSQLVHIGLAHEPDRMKRMEPSIGLNPIQEILIGPGLDLEFESDVDPSAPEPAQYETAYVTSHKSPCRAGAFSIDGQLCATGSVDASIKILDVDRMLAKSSMESSEPQNDQQGHPVIRTLYDHIEEVTCLEFHPSAPILASGSKDKTVKMFDYSKSSVRKAHKTIQESTFVRCLSFHPCGDYMVVGTDHFVLRLYSSDGRIYCSGSKDGDIKIWDGVSSKCVATFSKAHDGAEISSLTFTRNGKYLLSSGKDSLVKLWELSSARCLIAYTGAGSMGQQFELTLTVDADV
cccHHccccHHHHHHHHHHHHHHHHHHHcccccccCEEcEEEccccccccccccHHHHHHHcccccccccccccccEEEEcccccEEEccccccEEEEcccccccccccccEEEcccccccEEEEEEcccccEEEEccccccEEEEEccccEECccccccccccccccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEEECccccEEEEECccccEEEEEcccccEEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEcccccccEEEEEEcccccc
****************QEALYRLIISQLYYDGHHPMAITLQSSCNVVEPCPPSDRLSQLVHIGLAHEPDR***MEPSIGLNPIQEILIGPGLDLEFESDVDPSAPEPAQYETAYVTSHKSPCRAGAFSIDGQLCATGSVDASIKILDVDRMLAKSSMESSEPQNDQQGHPVIRTLYDHIEEVTCLEFHPSAPILASGSKDKTVKMFDYSKSSVRKAHKTIQESTFVRCLSFHPCGDYMVVGTDHFVLRLYSSDGRIYCSGSKDGDIKIWDGVSSKCVATFSKAHDGAEISSLTFTRNGKYLLSSGKDSLVKLWELSSARCLIAYTGAGSMGQQFELTLTVDA*V
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEQNEQKSSAEVLRRQEALYRLIISQLYYDGHHPMAITLQSSCNVVEPCPPSDRLSQLVHIGLAHEPDRMKRMEPSIGLNPIQEILIGPGLDLEFESDVDPSAPEPAQYETAYVTSHKSPCRAGAFSIDGQLCATGSVDASIKILDVDRMLAKSSMESSEPQNDQQGHPVIRTLYDHIEEVTCLEFHPSAPILASGSKDKTVKMFDYSKSSVRKAHKTIQESTFVRCLSFHPCGDYMVVGTDHFVLRLYSSDGRIYCSGSKDGDIKIWDGVSSKCVATFSKAHDGAEISSLTFTRNGKYLLSSGKDSLVKLWELSSARCLIAYTGAGSMGQQFELTLTVDADV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cleavage stimulation factor subunit 1 One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.confidentQ99LC2
Cleavage stimulation factor subunit 1 One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.confidentQ5BJQ6
Cleavage stimulation factor subunit 1 One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.confidentQ05048

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ERJ, chain A
Confidence level:very confident
Coverage over the Query: 118-150,169-335
View the alignment between query and template
View the model in PyMOL
Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 103-150,169-342
View the alignment between query and template
View the model in PyMOL
Template: 1ERJ, chain A
Confidence level:very confident
Coverage over the Query: 116-159,177-341
View the alignment between query and template
View the model in PyMOL