Diaphorina citri psyllid: psy15170


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MEYPAIVELNVGGVFYTTSLSTITRDPSSHIARLFSNPENSPQKDAKGKYFIDRDGVLFRYVLDYLRNQMLILPESFREKERLRQEAIYYGLPAMIDSIFHSDDSKRGAGYITIGYRGSFAFGRDGLADVKFRKITRILVCGRVTLCRDVFGETLNESRDPDHGLTDRYTARFFLKHSSIEQAFDMLQEQGFHLVGSCGSGTAGSTAPSDLKPGVDAEESRWNHYNEFVFCRE
ccccccEEEEEccEEEEEcHHHHccccccHHHHHHccccccccccccccEEEccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccEEEEEEc
**YPAIVELNVGGVFYTTSLSTITRDPSSHIARLFSNPENSPQKDAKGKYFIDRDGVLFRYVLDYLRNQMLILPESFREKERLRQEAIYYGLPAMIDSIFHSDDSKRGAGYITIGYRGSFAFGRDGLADVKFRKITRILVCGRVTLCRDVFGETLNESRDPDHGLTDRYTARFFLKHSSIEQAFDMLQEQGFHLVGSCGSG**************DAEESRWNHYNEFVFCRE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYPAIVELNVGGVFYTTSLSTITRDPSSHIARLFSNPENSPQKDAKGKYFIDRDGVLFRYVLDYLRNQMLILPESFREKERLRQEAIYYGLPAMIDSIFHSDDSKRGAGYITIGYRGSFAFGRDGLADVKFRKITRILVCGRVTLCRDVFGETLNESRDPDHGLTDRYTARFFLKHSSIEQAFDMLQEQGFHLVGSCGSGTAGSTAPSDLKPGVDAEESRWNHYNEFVFCRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0043235 [CC]receptor complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DRX, chain A
Confidence level:very confident
Coverage over the Query: 3-109,124-159
View the alignment between query and template
View the model in PyMOL