Diaphorina citri psyllid: psy15178

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MILIAFSLIVTTRQYVGNPIDCVHTKDIPEDVLNTYCWIHSTYTIRAAFKKKVGVAVPYPGVDNSRGKVEDRKTYGYYHLSCTKGYLASFYAGNTCSSVLLVG
cHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccEEEcccccHHHHHHHHHHHccccccccccccc
MILIAFSLIVTTRQYVGNPIDCVHTKDIPEDVLNTYCWIHSTYTIRAAFKKKVGVAVPYPGVDNSRGKVEDRKTYGYYHLSCTKGYLASFYAGNTCSSVLLVG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILIAFSLIVTTRQYVGNPIDCVHTKDIPEDVLNTYCWIHSTYTIRAAFKKKVGVAVPYPGVDNSRGKVEDRKTYGYYHLSCTKGYLASFYAGNTCSSVLLVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Innexin shaking-B Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina. Isoform Lethal forms voltage sensitive intercellular channels through homotypic interactions.confidentP33085
Innexin shaking-B Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina.confidentQ7PXN1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0007630 [BP]jump responseprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0003254 [BP]regulation of membrane depolarizationprobableGO:0032844, GO:2000021, GO:0008150, GO:0065007, GO:0050794, GO:0050789
GO:0010644 [BP]cell communication by electrical couplingprobableGO:0008150, GO:0007154, GO:0009987, GO:0044763, GO:0044699
GO:0005921 [CC]gap junctionprobableGO:0005575, GO:0030054, GO:0005911
GO:0016264 [BP]gap junction assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0034329, GO:0044699
GO:0009881 [MF]photoreceptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0010496 [BP]intercellular transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0005243 [MF]gap junction channel activityprobableGO:0005215, GO:0022857, GO:0015267, GO:0003674, GO:0022829, GO:0022803
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted