Diaphorina citri psyllid: psy15182


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
SALVQKPKKNITFIFLSGFQSRRESHVNVNVTPTCQDLSSDTPEIRKYKKKFGSEILCAALWGVNLLIGTETGLMLLDRSGQGKVYQLVNRRRFQQMEVLEGQNILVTISGKRNRVRVFYLSWLKSKILKMDGQVERRNGWINVGDLQGAVHFRIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKSFGELGYRPLLVDLTVEEGTRLKVIYGSADGFHAVDLDSAMVYDIYLPKHIQGPICPHCIVALPNSNGMQLLLCYDNEGVYVNTYGKVSKNILLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVETGHLDGVFMHKKSQRLKFLCERNDKVFFSSAKGGGHCQIYFMTLNKPCMANW
ccccccccccEEEEEcccccccccccEEEEccccccccccccccEEEcccccccEEEEEEEEccEEEEEEccEEEEEECcccccEEEEcccccEEEEEEEccccEEEEEEccccEEEEEEccccccccccccccccccccCEEEECccccEEEEEEEEccEEEEEEEEcccEEEEEECcccccccccEEECccccccccEEEEEEEEccEEEEEEECccCEEEEEcccccEEEcccccccccccccCEEEEEccccccEEEEEEccEEEEEEccccccccEEEEEcccccEEEEccccCEEECcccEEEEEEcccccEEEEEEccccccEEEEEEEccEEEEEEcccccCEEEEEEEccccccccc
**********IT***LSGFQSRRESHVNVNVTPTCQ*******EIRKYKKKFGSEILCAALWGVNLLIGTETGLMLLDRSGQGKVYQLVNRRRFQQMEVLEGQNILVTISGKRNRVRVFYLSWLKSKILKMDGQVERRNGWINVGDLQGAVHFRIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKSFGELGYRPLLVDLTVEEGTRLKVIYGSADGFHAVDLDSAMVYDIYLPKHIQGPICPHCIVALPNSNGMQLLLCYDNEGVYVNTYGKVSKNILLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVETGHLDGVFMHKKSQRLKFLCERNDKVFFSSAKGGGHCQIYFMTLNKPC****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SALVQKPKKNITFIFLSGFQSRRESHVNVNVTPTCQDLSSDTPEIRKYKKKFGSEILCAALWGVNLLIGTETGLMLLDRSGQGKVYQLVNRRRFQQMEVLEGQNILVTISGKRNRVRVFYLSWLKSKILKMDGQVERRNGWINVGDLQGAVHFRIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKSFGELGYRPLLVDLTVEEGTRLKVIYGSADGFHAVDLDSAMVYDIYLPKHIQGPICPHCIVALPNSNGMQLLLCYDNEGVYVNTYGKVSKNILLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVETGHLDGVFMHKKSQRLKFLCERNDKVFFSSAKGGGHCQIYFMTLNKPCMANW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Traf2 and NCK-interacting protein kinase Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading.confidentP83510
Misshapen-like kinase 1 Serine/threonine kinase which acts as a negative regulator ofRas-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1.confidentF1LP90
Serine/threonine-protein kinase mig-15 Involved in cell migration and signal transduction. Important in several developmental processes including epidermal development, Q neuroblast migrations and muscle arm targeting. Required with ina-1/pat-3 to stabilize the commissural axons growth cone along a precise direction and are required for the cell to respond appropriately when signaling in the growth cone must change.confidentQ23356

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006468 [BP]protein phosphorylationconfidentGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004674 [MF]protein serine/threonine kinase activityconfidentGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0006950 [BP]response to stressconfidentGO:0050896, GO:0008150
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007243 [BP]intracellular protein kinase cascadeconfidentGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0046330 [BP]positive regulation of JNK cascadeprobableGO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0046328, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043408, GO:0009966, GO:0009967, GO:0065007, GO:0048518, GO:0010740, GO:0070302, GO:0070304, GO:0050794, GO:0043410, GO:0008150, GO:0032874, GO:0032872, GO:0080134, GO:0080135, GO:0048522
GO:0048814 [BP]regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0022407 [BP]regulation of cell-cell adhesionprobableGO:0008150, GO:0030155, GO:0065007, GO:0050789, GO:0050794
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0001952 [BP]regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0008594 [BP]photoreceptor cell morphogenesisprobableGO:0032502, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0042461, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0000904, GO:0044763, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0046530, GO:0008150
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0060027 [BP]convergent extension involved in gastrulationprobableGO:0048598, GO:0002009, GO:0060429, GO:0044707, GO:0060026, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0042656 [MF]JUN kinase kinase kinase kinase activityprobableGO:0016301, GO:0060089, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0008349, GO:0004674, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0045060 [BP]negative thymic T cell selectionprobableGO:0030154, GO:0042110, GO:0045321, GO:0043383, GO:0007275, GO:0044699, GO:0045058, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0033077, GO:0030217, GO:0009987, GO:0048731, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0030097, GO:0002521, GO:0002520, GO:0045061, GO:0044707, GO:0048856, GO:0002376, GO:0030098, GO:0008150
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0016476 [BP]regulation of embryonic cell shapeprobableGO:0022604, GO:0051239, GO:0022603, GO:0050793, GO:0051128, GO:0008150, GO:0008360, GO:2000026, GO:0045995, GO:0065007, GO:0065008, GO:0050789, GO:0050794
GO:0046529 [BP]imaginal disc fusion, thorax closureprobableGO:0048563, GO:0048569, GO:0009887, GO:0009791, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007552, GO:0048513, GO:0046528, GO:0032502, GO:0048707, GO:0009886, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731
GO:0046580 [BP]negative regulation of Ras protein signal transductionprobableGO:0051056, GO:0009968, GO:0050794, GO:0009966, GO:0048583, GO:0048585, GO:0046578, GO:0051058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0007097 [BP]nuclear migrationprobableGO:0051234, GO:0040023, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0001748 [BP]optic lobe placode developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0040039 [BP]inductive cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005083 [MF]small GTPase regulator activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:2000311 [BP]regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activityprobableGO:0032879, GO:0032412, GO:0051049, GO:0009966, GO:0022898, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0032409, GO:0065007, GO:0034762, GO:0034765, GO:1900449, GO:0065009, GO:0010646, GO:0010469, GO:0050789, GO:0043269
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007256 [BP]activation of JNKK activityprobableGO:0000186, GO:0031401, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0050896, GO:0031325, GO:0048583, GO:0032147, GO:0051247, GO:0051174, GO:0007165, GO:0023051, GO:0046328, GO:0035556, GO:0010646, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0007254, GO:0051347, GO:0010604, GO:0009966, GO:0010562, GO:0043549, GO:0000165, GO:0031098, GO:0060255, GO:0051246, GO:0032268, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0051716, GO:0050794, GO:0032872, GO:0006950, GO:0051403, GO:0044763, GO:0023052, GO:0007154, GO:0042325, GO:0044700, GO:0042327, GO:0001932, GO:0007243, GO:0080134, GO:0080135, GO:0051338, GO:0033554, GO:0008150, GO:0009987, GO:0045860, GO:0001934, GO:0048522
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ODT, chain A
Confidence level:probable
Coverage over the Query: 44-357
View the alignment between query and template
View the model in PyMOL
Template: 2OVR, chain B
Confidence level:probable
Coverage over the Query: 54-360
View the alignment between query and template
View the model in PyMOL