Diaphorina citri psyllid: psy15185

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-

MPNAFVNSGLVIGTVGTILIGILCTYCLHVLVRSQYELCKKKRVPILNYPDSMRVALQQGPPCLRFAANASAIIVDMFLIVYQLGICCVYIMFVATNIKPVSIYYFSSNKQPLDDSTPYDPHKHRVLEHATTNNETLIHLLKGSLGTGILAMPNAFVNSGLVIGTVGTILIGILCTYCLHVLVRSQYELCKKKRVPILNYPDSMRVALQQGPPCLRFAANASAIIVDMFLIVYQLGICCVYIMFVATNIKPVTDAYIAVMDVRIVMVLLLLPLIGINSIRNLKLLAPFSQLANVITFIGLGITMYYICQALPPVSSRPYFGDPRNWNLFIGTTLFALEAVGVVIALENNMKTPASFGGYYGVLNQGMFAIVIMYVIMGFLGYVKYGSAAQGSVTLNLPKEDIIGIVLAVLVPRLELFISLFGAFCLSALGIAFPGIIEMCVLWPDQFGPFKFILIRDILLIIGGIFALILGTFISLQDIVRSFKLDLSMNYVIALENNMKTPASFGGYYGVLNQGMFAIVIMYVIMGFLGYVKYGSAAQGSVTLNLPKEDILAQSVNAIFAVAIFISYGLQCYVPVEIIWSRYLKQHLENATPGKKLLVEYIMRVSVVGSK

cHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEECcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHECccccccEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHEEEEEEEEcc

MPNAFVNSGLVIGTVGTILIGILCTYCLHVLVRSQYELCKKKRVPILNYPDSMRVALQQGPPCLRFAANASAIIVDMFLIVYQLGICCVYIMFVATNIKPVSIYYFSSNKQPLDDSTPYDPHK*RVLEHATTNNETLIHLLKGSLGTGILAMPNAFVNSGLVIGTVGTILIGILCTYCLHVLVRSQYELCKKKRVPILNYPDSMRVALQQGPPCLRFAANASAIIVDMFLIVYQLGICCVYIMFVATNIKPVTDAYIAVMDVRIVMVLLLLPLIGINSIRNLKLLAPFSQLANVITFIGLGITMYYICQALPPVSSRPYFGDPRNWNLFIGTTLFALEAVGVVIALENNMKTPASFGGYYGVLNQGMFAIVIMYVIMGFLGYVKYGSAAQGSVTLNLPKEDIIGIVLAVLVPRLELFISLFGAFCLSALGIAFPGIIEMCVLWPDQFGPFKFILIRDILLIIGGIFALILGTFISLQDIVRSFKLDLSMNYVIALENNMKTPASFGGYYGVLNQGMFAIVIMYVIMGFLGYVKYGSAAQGSVTLNLPKEDILAQSVNAIFAVAIFISYGLQCYVPVEIIWSRYLKQHLENATPGKKLLVEYIMRVSVVGSK

xxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Proton-coupled amino acid transporter 1	Neutral amino acid/proton symporter. Probably involved in the efflux of lysosomal proteolysis products such as L-proline, L-alanine and glycine from the cell. May play a role in specifying sites for exocytosis in neurons.	confident	Q924A5
Proton-coupled amino acid transporter 1	Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid.	confident	Q8K4D3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0015804 [BP]	neutral amino acid transport	probable	GO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 128-208,219-388
View the alignment between query and template
View the model in PyMOL

Template: 2XQ2, chain A
Confidence level:probable
Coverage over the Query: 74-95,131-208,219-302
View the alignment between query and template
View the model in PyMOL