Diaphorina citri psyllid: psy15187


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MAKYTLTKKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVSKRETNDDRTPVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDPDSIAMETDK
ccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccEEEEEcccccHHHHHHHHcccccEEEEEEEEcccccccccccccccccccccccccEEEEcccHHHHHHHHHHHcccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
************************************************************************************************************************************************GNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTF**********TDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPIN************************RHQVIYDDDIFG*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKYTLTKKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVSKRETNDDRTPVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDPDSIAMETDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Negative elongation factor E Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex, causes transcriptional pausing.confidentP92204

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007070 [BP]negative regulation of transcription from RNA polymerase II promoter during mitosisprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0046021, GO:0010629, GO:0007068, GO:0050789, GO:0010605, GO:0019222, GO:0000122, GO:2000112, GO:2000113, GO:0060255, GO:0010556, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045896, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0006357, GO:0008150, GO:0010558, GO:0048523
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0034244 [BP]negative regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 146-238
View the alignment between query and template
View the model in PyMOL