Psyllid ID: psy15187


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MAKYTLTKKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVSKRETNDDRTPVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDPDSIAMETDK
ccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccEEEEEcccccHHHHHHHHcccccEEEEEEEEcccccccccccccccccccccccccEEEEcccHHHHHHHHHHHcccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHcccccEEEEEEEEEcccEEEEccccccccHHHcccccEEEEEcccHHHHHHHHHHHccccEccEEEEEEEEcccccccccccccccccHHHHcccccccccccccccEEEEccHHccccccccccccEEEcccc
makytltkkslqaqkaprpepertqasstlkrpieAKDAREVARKLLKsgainpivrppkrceqegfkrprglerkltetdrstvsayqpfsaiqpedsepvdskpkflkvskretnddrtpvdkkvygeslltrlapnekpkggntifvqgagisEEFLRQHFSIFGKICSVSMEvekgrgfvtfdspessdkaitddcargfvtfdspessdkaiteVNGTHVQGVKLKVSLARRQlkvapindaassttWSAIACHQslkgnhkdkrhqviydddifgeeppledpdsiametdk
makytltkkslqaqkaprpepertqasstlkrpieakDAREVARKLlksgainpivrppkrceqegfkrprglerkltetdrstvsayqpfsaiqpedsepvdskpkflkvskretnddrtpvdkkvygeslltrlapnekpkggnTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGfvtfdspessdkaITDDCARGFVTFdspessdkaitevngthvqgVKLKVSLARRQLKVapindaassttWSAIACHQslkgnhkdkrHQVIYDDDifgeeppledpdsiametdk
MAKYTLTKKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVSKRETNDDRTPVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDPDSIAMETDK
************************************************************************************************************************************************GNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTF**********TDDCARGFVTF*********ITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKG*****RHQVIYDDDIF******************
**************************************************************************************************************************************************TIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTF**************ARGFVTFDSPESSDKAITEVNGTHVQGVKLKVS******************************************DDDIFG*****************
********************************PIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVS*********PVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDP*********
*AKYTLTKKSLQAQK****************RPIE*KDAREVARKLLKS*********************************************************************************************KGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPIN**********************DKRHQVIYDDDIFGEEPPLEDPDSIAM****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKYTLTKKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERKLTETDRSTVSAYQPFSAIQPEDSEPVDSKPKFLKVSKRETNDDRTPVDKKVYGESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDDIFGEEPPLEDPDSIAMETDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
P92204280 Negative elongation facto yes N/A 0.791 0.842 0.435 2e-52
Q95ZE9281 Negative elongation facto N/A N/A 0.798 0.846 0.440 5e-50
Q0V898374 Negative elongation facto yes N/A 0.389 0.310 0.373 2e-20
P18615380 Negative elongation facto yes N/A 0.389 0.305 0.366 5e-20
P19426375 Negative elongation facto yes N/A 0.379 0.301 0.366 3e-19
Q5R8F7 636 Polyadenylate-binding pro no N/A 0.251 0.117 0.377 1e-06
P11940 636 Polyadenylate-binding pro no N/A 0.251 0.117 0.377 1e-06
P61286 636 Polyadenylate-binding pro no N/A 0.251 0.117 0.377 1e-06
P29341 636 Polyadenylate-binding pro no N/A 0.251 0.117 0.377 1e-06
Q9EPH8 636 Polyadenylate-binding pro no N/A 0.251 0.117 0.377 1e-06
>sp|P92204|NELFE_DROME Negative elongation factor E OS=Drosophila melanogaster GN=Nelf-E PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (523), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/271 (43%), Positives = 168/271 (61%), Gaps = 35/271 (12%)

Query: 17  PRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLERK 76
           P+PEPE   +S TLKRP +A+DAREVARKL+KSGAI P ++   + +Q  FKRP+G ER 
Sbjct: 37  PKPEPE---SSLTLKRPTDARDAREVARKLIKSGAI-PAIQKQTKQDQTSFKRPKGQERA 92

Query: 77  LTETDRSTVSAYQPFSAIQPE------DSEPVDSKPKFLKVSKR-ETNDDRTPVDKKVYG 129
              T  +TV++YQPFS+ Q +       SE +  +P+   + +   T  DR   +++   
Sbjct: 93  KRSTSETTVASYQPFSSTQNDVAQETIISEIIKEEPRRQNLYQHFATERDR---EERGMP 149

Query: 130 ESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSP 189
           E +    A  EKP+ GNTIFV G  ++E+FL++ F+ +G I +VSME+EK          
Sbjct: 150 EKVPMDTAQPEKPRAGNTIFVSGNKVTEDFLKKTFNDYGTIVNVSMEIEK---------- 199

Query: 190 ESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAAS 249
                      +RGFV+F  PES+D+AI E++G +V G+ L+V LARRQ ++ PINDA+S
Sbjct: 200 -----------SRGFVSFAKPESADRAIAEIHGKNVNGINLQVQLARRQPQIEPINDASS 248

Query: 250 STTWSAIACHQSLKGNHKDKRHQVIYDDDIF 280
           S  WS+IA  +S KG+HKD R  V YD+D  
Sbjct: 249 SAVWSSIAASKSQKGSHKDHREMVQYDEDFL 279




Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex, causes transcriptional pausing.
Drosophila melanogaster (taxid: 7227)
>sp|Q95ZE9|NELFE_DROVI Negative elongation factor E OS=Drosophila virilis GN=Nelf-E PE=3 SV=1 Back     alignment and function description
>sp|Q0V898|NELFE_BOVIN Negative elongation factor E OS=Bos taurus GN=RDBP PE=2 SV=1 Back     alignment and function description
>sp|P18615|NELFE_HUMAN Negative elongation factor E OS=Homo sapiens GN=RDBP PE=1 SV=3 Back     alignment and function description
>sp|P19426|NELFE_MOUSE Negative elongation factor E OS=Mus musculus GN=Rdbp PE=1 SV=2 Back     alignment and function description
>sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 Back     alignment and function description
>sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 Back     alignment and function description
>sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 Back     alignment and function description
>sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
242025524273 Negative elongation factor E, putative [ 0.771 0.842 0.463 3e-53
91078286270 PREDICTED: similar to Negative elongatio 0.768 0.848 0.471 8e-52
24661022280 negative elongation factor E [Drosophila 0.791 0.842 0.435 1e-50
380018252275 PREDICTED: negative elongation factor E- 0.795 0.861 0.456 2e-50
194865848280 GG15071 [Drosophila erecta] gi|190653416 0.791 0.842 0.431 2e-50
328790245275 PREDICTED: negative elongation factor E 0.795 0.861 0.456 2e-50
195326059280 GM24927 [Drosophila sechellia] gi|194118 0.791 0.842 0.431 3e-50
195491140280 GE21294 [Drosophila yakuba] gi|194179535 0.791 0.842 0.431 3e-50
307202249272 Negative elongation factor E [Harpegnath 0.795 0.871 0.447 5e-50
125978160282 GA19284 [Drosophila pseudoobscura pseudo 0.795 0.840 0.437 2e-49
>gi|242025524|ref|XP_002433174.1| Negative elongation factor E, putative [Pediculus humanus corporis] gi|212518715|gb|EEB20436.1| Negative elongation factor E, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  214 bits (546), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 169/272 (62%), Gaps = 42/272 (15%)

Query: 16  APRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGFKRPRGLER 75
           AP+PEPE+   +   KRP E +DA+E A+KL+KSGAI    + P+R EQ GFKRP GLER
Sbjct: 36  APKPEPEKQ--TILPKRPAEGRDAKERAKKLVKSGAIT-TSKTPRRPEQAGFKRPMGLER 92

Query: 76  KLTETDRSTVSAYQPFSAIQPEDSEPVDSKPK-------FLKVSKRETNDDRTPVDKKVY 128
           KL+  +R TVS YQPFSA QPE++   +S+PK       F+    RE         ++  
Sbjct: 93  KLSGVER-TVSGYQPFSATQPEEAPETESRPKVKNLYDSFVSARDRE---------ERGL 142

Query: 129 GESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDS 188
           G+    +  P+ KP+ GNTIFV G  I+E+ LR+ F   G I +VSME+EK RGFVT   
Sbjct: 143 GDKQKEQGKPD-KPRQGNTIFVSGYKITEDLLRKTFQGMGNIVNVSMEIEKNRGFVT--- 198

Query: 189 PESSDKAITDDCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAA 248
                             FD  +++++AI E++G+ V GV+LKVSLARRQ  V  INDA+
Sbjct: 199 ------------------FDKMDAAERAINEMDGSMVSGVQLKVSLARRQPVVEAINDAS 240

Query: 249 SSTTWSAIACHQSLKGNHKDKRHQVIYDDDIF 280
           SS+TWS IA   S KGNHKDKR  ++Y++D+F
Sbjct: 241 SSSTWSTIAASHSQKGNHKDKRDVIVYEEDLF 272




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91078286|ref|XP_971953.1| PREDICTED: similar to Negative elongation factor E CG5994-PA [Tribolium castaneum] gi|270003949|gb|EFA00397.1| hypothetical protein TcasGA2_TC003247 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|24661022|ref|NP_648241.1| negative elongation factor E [Drosophila melanogaster] gi|38372288|sp|P92204.1|NELFE_DROME RecName: Full=Negative elongation factor E gi|1749772|emb|CAA71123.1| ANON-66Da protein [Drosophila melanogaster] gi|1749776|emb|CAA71120.1| ANON-66Da protein [Drosophila melanogaster] gi|7295068|gb|AAF50394.1| negative elongation factor E [Drosophila melanogaster] gi|17945251|gb|AAL48683.1| RE14181p [Drosophila melanogaster] gi|220947970|gb|ACL86528.1| Nelf-E-PA [synthetic construct] gi|220957250|gb|ACL91168.1| Nelf-E-PA [synthetic construct] Back     alignment and taxonomy information
>gi|380018252|ref|XP_003693047.1| PREDICTED: negative elongation factor E-like [Apis florea] Back     alignment and taxonomy information
>gi|194865848|ref|XP_001971633.1| GG15071 [Drosophila erecta] gi|190653416|gb|EDV50659.1| GG15071 [Drosophila erecta] Back     alignment and taxonomy information
>gi|328790245|ref|XP_394669.2| PREDICTED: negative elongation factor E [Apis mellifera] Back     alignment and taxonomy information
>gi|195326059|ref|XP_002029748.1| GM24927 [Drosophila sechellia] gi|194118691|gb|EDW40734.1| GM24927 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195491140|ref|XP_002093434.1| GE21294 [Drosophila yakuba] gi|194179535|gb|EDW93146.1| GE21294 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|307202249|gb|EFN81733.1| Negative elongation factor E [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|125978160|ref|XP_001353113.1| GA19284 [Drosophila pseudoobscura pseudoobscura] gi|195173466|ref|XP_002027512.1| GL10297 [Drosophila persimilis] gi|54641864|gb|EAL30614.1| GA19284 [Drosophila pseudoobscura pseudoobscura] gi|194114413|gb|EDW36456.1| GL10297 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
FB|FBgn0017430280 Nelf-E "Negative elongation fa 0.620 0.660 0.477 7.8e-62
UNIPROTKB|Q95ZE9281 Nelf-E "Negative elongation fa 0.624 0.661 0.472 6.1e-60
UNIPROTKB|B4DUN1350 NELFE "cDNA FLJ52247, highly s 0.261 0.222 0.458 7.3e-23
UNIPROTKB|K7GQ47373 RDBP "Uncharacterized protein" 0.261 0.209 0.470 1.4e-22
UNIPROTKB|Q0V898374 RDBP "Negative elongation fact 0.261 0.208 0.470 1.4e-22
UNIPROTKB|F1RQW5378 RDBP "Uncharacterized protein" 0.261 0.206 0.470 1.5e-22
ZFIN|ZDB-GENE-040718-69378 nelfe "negative elongation fac 0.248 0.195 0.469 2.6e-22
UNIPROTKB|P18615380 NELFE "Negative elongation fac 0.261 0.205 0.458 4.5e-22
UNIPROTKB|B4DYX9387 NELFE "cDNA FLJ56180, highly s 0.261 0.201 0.458 5.1e-22
UNIPROTKB|F1LP40344 Rdbp "Protein Rdbp" [Rattus no 0.251 0.218 0.463 2e-21
FB|FBgn0017430 Nelf-E "Negative elongation factor E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 411 (149.7 bits), Expect = 7.8e-62, Sum P(2) = 7.8e-62
 Identities = 94/197 (47%), Positives = 131/197 (66%)

Query:     8 KKSLQAQKAPRPEPERTQASSTLKRPIEAKDAREVARKLLKSGAINPIVRPPKRCEQEGF 67
             KK+LQA KAP+PEPE   +S TLKRP +A+DAREVARKL+KSGAI P ++   + +Q  F
Sbjct:    28 KKALQAHKAPKPEPE---SSLTLKRPTDARDAREVARKLIKSGAI-PAIQKQTKQDQTSF 83

Query:    68 KRPRGLERKLTETDRSTVSAYQPFSAIQPEDS-EPVDSKPKFLKVSKRETN---DDRTPV 123
             KRP+G ER    T  +TV++YQPFS+ Q + + E + S+   +K   R  N      T  
Sbjct:    84 KRPKGQERAKRSTSETTVASYQPFSSTQNDVAQETIISE--IIKEEPRRQNLYQHFATER 141

Query:   124 DKKVYG--ESLLTRLAPNEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGR 181
             D++  G  E +    A  EKP+ GNTIFV G  ++E+FL++ F+ +G I +VSME+EK R
Sbjct:   142 DREERGMPEKVPMDTAQPEKPRAGNTIFVSGNKVTEDFLKKTFNDYGTIVNVSMEIEKSR 201

Query:   182 GFVTFDSPESSDKAITD 198
             GFV+F  PES+D+AI +
Sbjct:   202 GFVSFAKPESADRAIAE 218


GO:0003729 "mRNA binding" evidence=ISS;IDA
GO:0007070 "negative regulation of transcription from RNA polymerase II promoter during mitosis" evidence=IDA
GO:0017053 "transcriptional repressor complex" evidence=IDA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0032021 "NELF complex" evidence=IPI
GO:0034244 "negative regulation of transcription elongation from RNA polymerase II promoter" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q95ZE9 Nelf-E "Negative elongation factor E" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUN1 NELFE "cDNA FLJ52247, highly similar to Negative elongation factor E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQ47 RDBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V898 RDBP "Negative elongation factor E" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQW5 RDBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-69 nelfe "negative elongation factor complex member E" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P18615 NELFE "Negative elongation factor E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DYX9 NELFE "cDNA FLJ56180, highly similar to Negative elongation factor E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP40 Rdbp "Protein Rdbp" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P92204NELFE_DROMENo assigned EC number0.43540.79190.8428yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 8e-28
smart0036073 smart00360, RRM, RNA recognition motif 8e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 9e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 5e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 9e-08
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 8e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 9e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-06
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 1e-06
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 1e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-06
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-06
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 4e-06
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-05
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 5e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 6e-05
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 6e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 8e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 9e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 4e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 4e-04
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 4e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-04
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-04
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-04
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 8e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 9e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.001
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.001
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.001
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.001
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.002
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.002
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.003
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 0.003
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.004
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.004
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
 Score =  102 bits (256), Expect = 8e-28
 Identities = 45/96 (46%), Positives = 60/96 (62%), Gaps = 21/96 (21%)

Query: 142 PKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCA 201
           P+ GNT++V G G++EE L++ FS FG I ++SME EK  GFVTF+              
Sbjct: 1   PRKGNTLYVHGYGLTEEILKKAFSPFGNIINISMEKEKNCGFVTFEK------------- 47

Query: 202 RGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARR 237
                    ES+D+AI E+NGT VQGV+LKVSLAR+
Sbjct: 48  --------MESADRAIAELNGTTVQGVQLKVSLARK 75


This subfamily corresponds to the RRM of NELF-E, also termed RNA-binding protein RD. NELF-E is the RNA-binding subunit of cellular negative transcription elongation factor NELF (negative elongation factor) involved in transcriptional regulation of HIV-1 by binding to the stem of the viral transactivation-response element (TAR) RNA which is synthesized by cellular RNA polymerase II at the viral long terminal repeat. NELF is a heterotetrameric protein consisting of NELF A, B, C or the splice variant D, and E. NELF-E contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It plays a role in the control of HIV transcription by binding to TAR RNA. In addition, NELF-E is associated with the NELF-B subunit, probably via a leucine zipper motif. . Length = 75

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.7
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.69
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.68
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.65
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.64
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.63
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.59
KOG0144|consensus 510 99.58
KOG0148|consensus321 99.56
KOG0131|consensus203 99.55
KOG0117|consensus 506 99.55
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.55
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.54
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.53
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.53
KOG0122|consensus270 99.53
KOG0121|consensus153 99.49
KOG0125|consensus 376 99.49
KOG0127|consensus 678 99.49
KOG0149|consensus247 99.46
KOG0113|consensus335 99.43
KOG0130|consensus170 99.41
KOG0145|consensus360 99.41
KOG4207|consensus 256 99.39
KOG0109|consensus 346 99.38
PLN03213 759 repressor of silencing 3; Provisional 99.36
PLN03120 260 nucleic acid binding protein; Provisional 99.36
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.36
KOG0107|consensus195 99.36
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.35
KOG0148|consensus 321 99.34
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.34
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.33
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.33
smart0036272 RRM_2 RNA recognition motif. 99.32
KOG0111|consensus 298 99.3
PLN03121 243 nucleic acid binding protein; Provisional 99.3
KOG0126|consensus219 99.29
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.29
KOG0145|consensus 360 99.26
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.26
smart0036170 RRM_1 RNA recognition motif. 99.25
smart0036071 RRM RNA recognition motif. 99.24
KOG4205|consensus311 99.21
KOG0108|consensus 435 99.19
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.18
KOG0123|consensus 369 99.17
KOG0117|consensus 506 99.16
KOG0124|consensus 544 99.15
KOG0132|consensus 894 99.14
KOG0127|consensus 678 99.13
KOG0146|consensus371 99.13
KOG0123|consensus369 99.12
KOG0105|consensus241 99.1
KOG0110|consensus725 99.09
KOG0114|consensus124 99.06
KOG0415|consensus479 99.06
KOG0147|consensus 549 98.98
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.9
KOG0153|consensus377 98.85
KOG4208|consensus214 98.82
KOG4206|consensus221 98.81
KOG4661|consensus 940 98.8
KOG0124|consensus 544 98.79
KOG0144|consensus510 98.77
KOG1548|consensus382 98.76
KOG0146|consensus 371 98.67
KOG0110|consensus725 98.6
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.57
KOG0151|consensus 877 98.56
KOG4205|consensus311 98.55
KOG0106|consensus216 98.53
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.49
KOG4209|consensus231 98.44
KOG4212|consensus 608 98.39
KOG0226|consensus290 98.38
KOG1457|consensus 284 98.34
KOG1456|consensus 494 98.34
KOG4212|consensus608 98.33
KOG4660|consensus 549 98.15
KOG0533|consensus243 98.14
KOG1190|consensus492 98.05
KOG0116|consensus419 98.01
KOG4454|consensus 267 97.96
KOG2314|consensus 698 97.85
KOG0120|consensus500 97.73
KOG4211|consensus 510 97.69
KOG1995|consensus 351 97.67
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.64
KOG0147|consensus 549 97.58
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.58
KOG0109|consensus 346 97.44
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.42
KOG0120|consensus500 97.4
KOG0131|consensus203 97.4
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.4
KOG4210|consensus285 97.37
KOG1457|consensus284 97.25
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.21
KOG1190|consensus 492 96.95
KOG1456|consensus494 96.94
KOG4206|consensus221 96.83
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.53
KOG0128|consensus881 96.47
KOG3152|consensus278 96.32
KOG1996|consensus378 96.17
KOG4849|consensus 498 96.06
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.01
KOG4307|consensus944 95.95
KOG2202|consensus260 95.92
KOG2416|consensus 718 95.8
KOG0129|consensus520 95.53
KOG0112|consensus 975 95.49
KOG2068|consensus 327 95.31
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.28
KOG1365|consensus508 95.15
KOG0129|consensus 520 95.1
KOG0112|consensus 975 94.54
KOG1855|consensus484 94.48
KOG2193|consensus 584 94.26
KOG0106|consensus216 94.02
KOG2135|consensus526 93.47
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.22
KOG0105|consensus241 92.96
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.8
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 91.22
KOG4285|consensus350 90.81
KOG0115|consensus 275 90.48
KOG4211|consensus 510 90.01
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 89.53
PF15023166 DUF4523: Protein of unknown function (DUF4523) 88.25
KOG4574|consensus 1007 87.64
KOG0122|consensus270 86.14
smart0036170 RRM_1 RNA recognition motif. 85.81
KOG4676|consensus 479 84.58
KOG4210|consensus285 84.43
KOG1548|consensus 382 82.04
KOG2253|consensus 668 81.47
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 80.52
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
Probab=99.70  E-value=3.1e-16  Score=132.91  Aligned_cols=83  Identities=25%  Similarity=0.491  Sum_probs=77.2

Q ss_pred             CCCcEEEEcC--CCCCHHHHHHHHhccCCeeEEEEeeecCceeEEecChhhhhhhhhcCCceEEEEeCCHHHHHHHHHHh
Q psy15187        143 KGGNTIFVQG--AGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEV  220 (298)
Q Consensus       143 ~~~~tLfVgn--~~~te~~L~~~F~~fG~I~~v~i~~dk~~gfV~f~~~~~adkai~~skGfaFV~F~~~e~A~~Ai~~l  220 (298)
                      ..+++|||+|  ++++|++|+++|.+||.|.+|.|+.|+.++.               ++|||||+|.+.++|+.||..|
T Consensus        32 ~~~~~lfVgnL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~---------------~kGfaFV~F~~~e~A~~Al~~l   96 (144)
T PLN03134         32 LMSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGR---------------SRGFGFVNFNDEGAATAAISEM   96 (144)
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEEecCCCCC---------------cceEEEEEECCHHHHHHHHHHc
Confidence            3457999999  9999999999999999999999999988876               8999999999999999999999


Q ss_pred             CCcEECCeEEEEEEcccccc
Q psy15187        221 NGTHVQGVKLKVSLARRQLK  240 (298)
Q Consensus       221 nG~~i~Gr~L~V~~A~~k~~  240 (298)
                      ||..|+|+.|+|.|+..++.
T Consensus        97 ng~~i~Gr~l~V~~a~~~~~  116 (144)
T PLN03134         97 DGKELNGRHIRVNPANDRPS  116 (144)
T ss_pred             CCCEECCEEEEEEeCCcCCC
Confidence            99999999999999987655



>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
2jx2_A121 Solution Structure Of Nelf E Rrm Length = 121 5e-11
1x5p_A97 Solution Structure Of Rrm Domain In Parp14 Length = 3e-10
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 7e-07
>pdb|2JX2|A Chain A, Solution Conformation Of Rna-Bound Nelf-E Rrm Length = 121 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 25/109 (22%) Query: 142 PKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCA 201 P+ GNT++V G ++ LR FS FG I +SM+ + FV Sbjct: 36 PRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV----------------- 78 Query: 202 RGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASS 250 T++ ES+D+A+ E+NGT V+ V+LKV++AR+Q P+ DAA+ Sbjct: 79 ----TYEKMESADQAVAELNGTQVESVQLKVNIARKQ----PMLDAATG 119
>pdb|1X5P|A Chain A, Solution Structure Of Rrm Domain In Parp14 Length = 97 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1x5p_A97 Negative elongation factor E; structure genomics, 1e-23
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 9e-22
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-14
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-14
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-14
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-14
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-14
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-13
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-13
1x5o_A114 RNA binding motif, single-stranded interacting pro 6e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-13
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 8e-13
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-07
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-06
1x4e_A85 RNA binding motif, single-stranded interacting pro 4e-12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 8e-12
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-12
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 9e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-11
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-10
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-08
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-10
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-11
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-09
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-11
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-11
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-11
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 5e-11
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-11
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-10
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-10
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-10
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 5e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 6e-10
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 7e-10
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-10
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 8e-10
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 9e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 1e-09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-09
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-09
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-09
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-09
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-09
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-09
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-09
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-09
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-09
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 6e-09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 8e-09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 8e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-08
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-08
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-08
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-08
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-08
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 5e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 6e-08
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 8e-08
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 8e-08
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-07
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-07
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-07
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-06
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-07
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-07
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-07
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-07
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 5e-07
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-07
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 6e-07
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-07
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 7e-07
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 7e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-07
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-07
2cqd_A116 RNA-binding region containing protein 1; RNA recog 9e-07
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 9e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-06
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-06
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-06
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-06
2div_A99 TRNA selenocysteine associated protein; structural 3e-06
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 7e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-05
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-05
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-04
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 7e-04
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
 Score = 91.2 bits (227), Expect = 1e-23
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 25/113 (22%)

Query: 139 NEKPKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITD 198
              P+ GNT++V G  ++   LR  FS FG I  +SM+  +   FV              
Sbjct: 9   RRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV-------------- 54

Query: 199 DCARGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQLKVAPINDAASST 251
                  T++  ES+D+A+ E+NGT V+ V+LKV++AR+Q    P+ D+  S+
Sbjct: 55  -------TYEKMESADQAVAELNGTQVESVQLKVNIARKQ----PMLDSGPSS 96


>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.83
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.79
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.79
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.78
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.76
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.76
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.76
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.76
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.75
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.75
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.75
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.75
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.75
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.75
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.75
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.75
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.75
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.75
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.75
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.74
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.74
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.74
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.74
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.74
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.74
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.74
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.74
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.74
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.73
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.73
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.72
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.72
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
2div_A99 TRNA selenocysteine associated protein; structural 99.72
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.72
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.72
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.72
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.71
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.71
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.71
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.71
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.71
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.71
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.71
2dis_A109 Unnamed protein product; structural genomics, RRM 99.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.7
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.7
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.7
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.7
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.7
1x5p_A97 Negative elongation factor E; structure genomics, 99.7
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.7
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.7
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.7
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.7
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.7
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.69
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.69
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.69
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.69
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.69
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.69
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.69
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.69
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.68
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.68
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.68
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.68
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.67
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.67
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.67
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.67
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.67
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.67
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.66
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.66
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.66
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.66
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.47
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.66
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.66
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.66
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.65
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.65
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.65
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.65
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.65
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.65
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.65
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.65
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.65
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.65
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.64
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.64
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.64
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.64
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.64
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.64
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.64
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.64
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.64
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.63
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.63
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.63
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.63
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.62
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.62
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.62
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.62
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.62
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.62
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.61
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.61
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.61
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.61
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.6
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.6
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.59
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.57
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.56
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.56
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.56
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.56
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.55
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.54
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.54
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.53
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.53
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.51
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.5
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.48
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.46
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.46
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.44
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.44
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.39
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.37
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.36
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.3
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.22
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.01
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.96
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.87
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.81
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.78
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.77
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.76
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.76
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.75
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.74
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.72
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.71
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.7
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.68
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.67
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.62
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.59
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.57
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.36
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.73
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.29
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.23
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.83
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.34
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.83
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 94.38
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 93.92
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 93.3
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.01
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 90.18
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 85.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 85.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 85.16
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 84.02
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 83.82
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 83.46
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 83.44
2krb_A81 Eukaryotic translation initiation factor 3 subunit 83.43
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 81.63
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 81.36
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 81.28
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 80.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 80.52
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 80.23
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 80.23
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 80.22
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 80.15
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 80.08
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.84  E-value=4.2e-21  Score=169.06  Aligned_cols=101  Identities=24%  Similarity=0.438  Sum_probs=90.4

Q ss_pred             CCCCcEEEEcC--CCCCHHHHHHHHhccCCeeEEEEeee------cCceeEEecChhhhhhhh-----------------
Q psy15187        142 PKGGNTIFVQG--AGISEEFLRQHFSIFGKICSVSMEVE------KGRGFVTFDSPESSDKAI-----------------  196 (298)
Q Consensus       142 ~~~~~tLfVgn--~~~te~~L~~~F~~fG~I~~v~i~~d------k~~gfV~f~~~~~adkai-----------------  196 (298)
                      ..+.++|||+|  +++|+++|+++|++||+|.+|.|++|      +++|||+|.+.++|++||                 
T Consensus        12 ~~p~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~~g~~i~~~~   91 (213)
T 4f02_A           12 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMW   91 (213)
T ss_dssp             ---CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHhhhhhcCCccccccc
Confidence            34568999999  99999999999999999999999986      479999999999999999                 


Q ss_pred             ------------------------------------------------hcCCceEEEEeCCHHHHHHHHHHhCCcEECCe
Q psy15187        197 ------------------------------------------------TDDCARGFVTFDSPESSDKAITEVNGTHVQGV  228 (298)
Q Consensus       197 ------------------------------------------------~~skGfaFV~F~~~e~A~~Ai~~lnG~~i~Gr  228 (298)
                                                                      +.++|||||+|.+.++|.+||..|||..|+|+
T Consensus        92 ~~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~~~g~  171 (213)
T 4f02_A           92 SQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDR  171 (213)
T ss_dssp             CCCCTHHHHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEETTEEEEEEEEEESSHHHHHHHHHHHTTCEETTE
T ss_pred             ccccccccccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccCCCCceEEEEEeCCHHHHHHHHHHhCCCEECCE
Confidence                                                            12689999999999999999999999999999


Q ss_pred             EEEEEEcccccccc
Q psy15187        229 KLKVSLARRQLKVA  242 (298)
Q Consensus       229 ~L~V~~A~~k~~~~  242 (298)
                      .|+|.||.++....
T Consensus       172 ~i~V~~a~~~~~~~  185 (213)
T 4f02_A          172 KVFVGRFKSRKERE  185 (213)
T ss_dssp             ECEEEECCCHHHHH
T ss_pred             EEEEEEcCCCcccc
Confidence            99999998765533



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 5e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-09
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-08
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 3e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 5e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-08
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-07
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 7e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 6e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 6e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 6e-05
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 9e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 9e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 3e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 4e-04
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 5e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 5e-04
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 7e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 8e-04
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 8e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 0.001
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.002
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 0.003
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 0.003
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Negative elongation factor E, NELF-E
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.0 bits (145), Expect = 1e-12
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 21/97 (21%)

Query: 142 PKGGNTIFVQGAGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCA 201
           P+ GNT++V G  ++   LR  FS FG I  +SM+  +                      
Sbjct: 2   PRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRN--------------------- 40

Query: 202 RGFVTFDSPESSDKAITEVNGTHVQGVKLKVSLARRQ 238
             FVT++  ES+D+A+ E+NGT V+ V+LKV++AR+Q
Sbjct: 41  CAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQ 77


>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.81
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.78
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.78
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.78
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.76
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.76
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.75
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.75
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.75
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.75
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.75
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.74
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.74
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.74
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.72
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.72
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.71
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.7
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.7
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.7
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.7
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.69
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.68
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.67
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.67
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.65
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.65
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.63
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.63
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.62
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.62
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.61
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.6
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.59
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.58
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.58
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.57
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.56
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.51
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.48
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.44
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.39
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.36
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.36
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.2
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.19
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.69
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.22
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.69
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 93.13
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 87.1
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 84.6
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 83.97
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 83.92
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 83.76
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 83.6
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 83.33
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 82.5
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 82.02
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 81.88
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 81.87
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 81.51
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 81.2
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 80.94
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 80.48
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 80.45
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 80.27
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]
Probab=99.82  E-value=3.8e-20  Score=138.26  Aligned_cols=78  Identities=28%  Similarity=0.421  Sum_probs=74.3

Q ss_pred             CcEEEEcC--CCCCHHHHHHHHhccCCeeEEEEeeecCceeEEecChhhhhhhhhcCCceEEEEeCCHHHHHHHHHHhCC
Q psy15187        145 GNTIFVQG--AGISEEFLRQHFSIFGKICSVSMEVEKGRGFVTFDSPESSDKAITDDCARGFVTFDSPESSDKAITEVNG  222 (298)
Q Consensus       145 ~~tLfVgn--~~~te~~L~~~F~~fG~I~~v~i~~dk~~gfV~f~~~~~adkai~~skGfaFV~F~~~e~A~~Ai~~lnG  222 (298)
                      +++|||+|  .++++++|+++|++||.|.+|.|+.++..|.               ++|||||+|.+.++|..||..|||
T Consensus         2 ~t~l~V~nLp~~~t~~~l~~~F~~~G~v~~~~i~~~~~~g~---------------~~g~afV~f~~~~~A~~ai~~lng   66 (82)
T d1b7fa1           2 NTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGY---------------SYGYAFVDFTSEMDSQRAIKVLNG   66 (82)
T ss_dssp             CSEEEEECCCTTCCHHHHHHHHHTTSCEEEEECCEETTTTE---------------ECSEEEEEESSHHHHHHHHHHHTT
T ss_pred             CCEEEEeCCCCCCCHHHHHHHHHHhCCcceeeeeeecccCC---------------ccccceEEECCHHHHHHHHHHhCC
Confidence            47899999  9999999999999999999999999988776               899999999999999999999999


Q ss_pred             cEECCeEEEEEEccc
Q psy15187        223 THVQGVKLKVSLARR  237 (298)
Q Consensus       223 ~~i~Gr~L~V~~A~~  237 (298)
                      ..|+|+.|+|.||++
T Consensus        67 ~~~~g~~l~v~~a~p   81 (82)
T d1b7fa1          67 ITVRNKRLKVSYARP   81 (82)
T ss_dssp             CEETTEECEEEECCC
T ss_pred             CEECCEEEEEEEcCC
Confidence            999999999999975



>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure