Diaphorina citri psyllid: psy15189

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150

MLPGYADPYHKRPMKKGEIGCFLSHYNIWNEVVDNNHDIVMVLEDDVRFESFFRQKLATILKELKTKTLPAWDLIYLGRKKLSEKPDTWVSGSRYLVEASYSYWTLGYLLSRQGARKLTQARPLSNLLPVDEFLPLLSGKHPEDLGLSGA

ccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccCEEEEEccccccEEccccHHHHHHHHHcccccccccHHcccHHHHccccccCEECcc

MLPGYADPYHKRPMKKGEIGCFLSHYNIWNEVVDNNHDIVMVLEDDVRFESFFRQKLATILKELKTKTLPAWDLIYLGRKKLSEKPDTWVSGSRYLVEASYSYWTLGYLLSRQGARKLTQARPLSNLLPVDEFLPLLSGKHPEDLGLSG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLPGYADPYHKRPMKKGEIGCFLSHYNIWNEVVDNNHDIVMVLEDDVRFESFFRQKLATILKELKTKTLPAWDLIYLGRKKLSEKPDTWVSGSRYLVEASYSYWTLGYLLSRQGARKLTQARPLSNLLPVDEFLPLLSGKHPEDLGLSGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glycosyltransferase 25 family member		confident	Q7Q021
Procollagen galactosyltransferase 1	Has a beta-galactosyltransferase activity; transfers beta-galactose to hydroxylysine residues of collagen.	confident	Q8K297
Procollagen galactosyltransferase 1	Has a beta-galactosyltransferase activity; transfers beta-galactose to hydroxylysine residues of collagen.	confident	Q8NBJ5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007155 [BP]	cell adhesion	probable	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FO8, chain A
Confidence level:probable
Coverage over the Query: 15-134
View the alignment between query and template
View the model in PyMOL