Diaphorina citri psyllid: psy15190


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
cCEEEcccccccccccccCEEEEEcccccEEEEEcccccCEEECcccccccCEEEccCEECcccEEEEEEccccEEEEEEcccEEEEEEccHHHHHHHHHHcccccccccccccccc
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongator complex protein 2 Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.confidentQ91WG4
Elongator complex protein 2 Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.confidentQ496Z0
Elongator complex protein 2 Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation.confidentQ5EBD9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0008023 [CC]transcription elongation factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046425 [BP]regulation of JAK-STAT cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0033588 [CC]Elongator holoenzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AQ5, chain A
Confidence level:confident
Coverage over the Query: 1-93
View the alignment between query and template
View the model in PyMOL
Template: 3SCY, chain A
Confidence level:probable
Coverage over the Query: 15-116
View the alignment between query and template
View the model in PyMOL