Psyllid ID: psy15190


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
cEEEEcccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEccEEEEcccEEEEEEccccEEEEEEcccEEEEEEccHHHHHHHHHHcccccccccccccccc
cccEEccccEEEEcccccccEEEEcccccEEEEEEcccccEEEcccccccccHEEcccccccccHHHHHHccccEEEccccHHEHHHccccHHHHHHHHHHcccccccccccEEEEc
mlvwaqqpcvtvgghfgpvrdiqwepsgqfIISVsedqttrlhapfvgkntwyemarpqvhgydlTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLcgldfsqhptnilfti
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISvsedqttrLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLcgldfsqhptnilfti
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
**VWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILF**
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
*LVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPTNILFTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q7K4B3 794 Probable elongator comple yes N/A 0.837 0.123 0.544 7e-29
Q5EBD9 824 Elongator complex protein yes N/A 0.803 0.114 0.530 9e-27
Q05AM5 821 Elongator complex protein yes N/A 0.871 0.124 0.471 2e-26
Q6IA86 826 Elongator complex protein no N/A 0.820 0.116 0.54 3e-26
Q496Z0 821 Elongator complex protein yes N/A 0.786 0.112 0.561 4e-26
Q91WG4 831 Elongator complex protein yes N/A 0.786 0.110 0.524 3e-25
O94533 760 Elongator complex protein yes N/A 0.888 0.136 0.429 5e-20
Q86H45 901 Probable elongator comple yes N/A 0.888 0.115 0.403 7e-19
P42935 788 Elongator complex protein yes N/A 0.829 0.123 0.380 1e-18
F4I1S7 838 Elongator complex protein yes N/A 0.854 0.119 0.363 1e-16
>sp|Q7K4B3|ELP2_DROME Probable elongator complex protein 2 OS=Drosophila melanogaster GN=Elp2 PE=1 SV=1 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 3/101 (2%)

Query: 8   PCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFV--GKN-TWYEMARPQVHGYD 64
           P V VGGH+G VRD+ WE SG ++++ S DQTTRLHAP++  G N TW+E+ARPQ+HGYD
Sbjct: 378 PGVIVGGHYGEVRDLAWEHSGAYLMTASADQTTRLHAPWLQDGANPTWHELARPQIHGYD 437

Query: 65  LTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLD 105
           +  LAL+S + FASGA+EK+VR F+   NF++N + + G++
Sbjct: 438 MQALALLSRYKFASGAEEKIVRTFQAPANFIENFRHISGIE 478




Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation (By similarity). Involved in the regulation of the STAT pathway.
Drosophila melanogaster (taxid: 7227)
>sp|Q5EBD9|ELP2_XENTR Elongator complex protein 2 OS=Xenopus tropicalis GN=elp2 PE=2 SV=1 Back     alignment and function description
>sp|Q05AM5|ELP2_DANRE Elongator complex protein 2 OS=Danio rerio GN=elp2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IA86|ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens GN=ELP2 PE=1 SV=2 Back     alignment and function description
>sp|Q496Z0|ELP2_RAT Elongator complex protein 2 OS=Rattus norvegicus GN=Elp2 PE=2 SV=1 Back     alignment and function description
>sp|Q91WG4|ELP2_MOUSE Elongator complex protein 2 OS=Mus musculus GN=Elp2 PE=1 SV=1 Back     alignment and function description
>sp|O94533|ELP2_SCHPO Elongator complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp2 PE=3 SV=1 Back     alignment and function description
>sp|Q86H45|ELP2_DICDI Probable elongator complex protein 2 OS=Dictyostelium discoideum GN=elp2 PE=3 SV=1 Back     alignment and function description
>sp|P42935|ELP2_YEAST Elongator complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP2 PE=1 SV=1 Back     alignment and function description
>sp|F4I1S7|ELP2_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana GN=ELP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
346468419 802 hypothetical protein [Amblyomma maculatu 0.897 0.130 0.570 5e-30
405954269 755 Elongator complex protein 2 [Crassostrea 0.863 0.133 0.586 6e-30
270013922 748 hypothetical protein TcasGA2_TC012601 [T 0.846 0.132 0.534 2e-28
91090664 762 PREDICTED: similar to GA11261-PA [Tribol 0.846 0.129 0.534 2e-28
427796527 544 Putative rna polymerase ii elongator com 0.880 0.189 0.547 3e-28
427788787 801 Putative rna polymerase ii elongator com 0.880 0.128 0.547 3e-28
195026473 805 GH21263 [Drosophila grimshawi] gi|193902 0.829 0.120 0.56 6e-28
157107945 788 hypothetical protein AaeL_AAEL004896 [Ae 0.957 0.142 0.483 3e-27
242023465 567 Stat3-interacting protein, putative [Ped 0.820 0.169 0.53 3e-27
19921984 794 elongator complex protein 2 [Drosophila 0.837 0.123 0.544 3e-27
>gi|346468419|gb|AEO34054.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (71%), Gaps = 2/107 (1%)

Query: 7   QPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFV--GKNTWYEMARPQVHGYD 64
           Q  V +GGHF  V DI W P G++++S S DQTTRLHAP+V  G  +W E+ARPQVHG+D
Sbjct: 382 QTSVALGGHFDKVADIAWAPDGEYLLSCSSDQTTRLHAPWVTSGGTSWKEIARPQVHGHD 441

Query: 65  LTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLDFSQHPT 111
           L C+A      F SGA+EKV+RAF  T+NFVDN +RLCG+D  QH +
Sbjct: 442 LGCIASTGRLQFVSGAEEKVLRAFEGTRNFVDNFKRLCGVDLLQHSS 488




Source: Amblyomma maculatum

Species: Amblyomma maculatum

Genus: Amblyomma

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405954269|gb|EKC21758.1| Elongator complex protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|270013922|gb|EFA10370.1| hypothetical protein TcasGA2_TC012601 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090664|ref|XP_974342.1| PREDICTED: similar to GA11261-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427796527|gb|JAA63715.1| Putative rna polymerase ii elongator complex subunit elp2 wd repeat superfamily, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427788787|gb|JAA59845.1| Putative rna polymerase ii elongator complex subunit elp2 wd repeat superfamily [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|195026473|ref|XP_001986264.1| GH21263 [Drosophila grimshawi] gi|193902264|gb|EDW01131.1| GH21263 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157107945|ref|XP_001650009.1| hypothetical protein AaeL_AAEL004896 [Aedes aegypti] gi|108879448|gb|EAT43673.1| AAEL004896-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242023465|ref|XP_002432154.1| Stat3-interacting protein, putative [Pediculus humanus corporis] gi|212517536|gb|EEB19416.1| Stat3-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|19921984|ref|NP_610600.1| elongator complex protein 2 [Drosophila melanogaster] gi|122126315|sp|Q7K4B3.1|ELP2_DROME RecName: Full=Probable elongator complex protein 2; Short=ELP2; AltName: Full=Stat3-interacting protein homolog gi|15292349|gb|AAK93443.1| LD47515p [Drosophila melanogaster] gi|21627505|gb|AAF58765.2| elongator complex protein 2 [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
FB|FBgn0033540 794 Elp2 "Elongator complex protei 0.863 0.127 0.528 4.3e-27
UNIPROTKB|F1NMC6 822 ELP2 "Uncharacterized protein" 0.829 0.118 0.554 1.6e-26
UNIPROTKB|E1BEP7 827 ELP2 "Uncharacterized protein" 0.820 0.116 0.55 2.5e-25
UNIPROTKB|Q5EBD9 824 elp2 "Elongator complex protei 0.803 0.114 0.530 4e-25
UNIPROTKB|I3L616 826 ELP2 "Uncharacterized protein" 0.820 0.116 0.55 4e-25
ZFIN|ZDB-GENE-060503-525 821 elp2 "elongation protein 2 hom 0.829 0.118 0.495 5.1e-25
UNIPROTKB|Q6IA86 826 ELP2 "Elongator complex protei 0.820 0.116 0.54 6.6e-25
RGD|1306419 821 Elp2 "elongator acetyltransfer 0.786 0.112 0.561 8.4e-25
MGI|MGI:1889642 831 Elp2 "elongator acetyltransfer 0.786 0.110 0.524 1e-23
ASPGD|ASPL0000003704 889 AN10832 [Emericella nidulans ( 0.846 0.111 0.446 4.6e-19
FB|FBgn0033540 Elp2 "Elongator complex protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 4.3e-27, P = 4.3e-27
 Identities = 56/106 (52%), Positives = 80/106 (75%)

Query:     3 VWAQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFV--GKN-TWYEMARPQ 59
             +W   P V VGGH+G VRD+ WE SG ++++ S DQTTRLHAP++  G N TW+E+ARPQ
Sbjct:   375 LWT--PGVIVGGHYGEVRDLAWEHSGAYLMTASADQTTRLHAPWLQDGANPTWHELARPQ 432

Query:    60 VHGYDLTCLALISTFVFASGADEKVVRAFRTTQNFVDNIQRLCGLD 105
             +HGYD+  LAL+S + FASGA+EK+VR F+   NF++N + + G++
Sbjct:   433 IHGYDMQALALLSRYKFASGAEEKIVRTFQAPANFIENFRHISGIE 478




GO:0006368 "transcription elongation from RNA polymerase II promoter" evidence=ISS
GO:0000502 "proteasome complex" evidence=ISS
GO:0043248 "proteasome assembly" evidence=ISS
GO:0061133 "endopeptidase activator activity" evidence=ISS
UNIPROTKB|F1NMC6 ELP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEP7 ELP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EBD9 elp2 "Elongator complex protein 2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|I3L616 ELP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-525 elp2 "elongation protein 2 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IA86 ELP2 "Elongator complex protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306419 Elp2 "elongator acetyltransferase complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1889642 Elp2 "elongator acetyltransferase complex subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000003704 AN10832 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91WG4ELP2_MOUSENo assigned EC number0.52470.78630.1107yesN/A
Q5EBD9ELP2_XENTRNo assigned EC number0.53060.80340.1140yesN/A
Q496Z0ELP2_RATNo assigned EC number0.56120.78630.1120yesN/A
Q7K4B3ELP2_DROMENo assigned EC number0.54450.83760.1234yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 39.6 bits (93), Expect = 1e-04
 Identities = 23/114 (20%), Positives = 43/114 (37%), Gaps = 13/114 (11%)

Query: 3   VW---AQQPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQ 59
           +W     +   T+ GH   V  + + P G+ + S S D+T ++     GK         +
Sbjct: 77  LWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCL----TTLR 132

Query: 60  VHGYDLTCLALI--STFVFASGADEKV----VRAFRTTQNFVDNIQRLCGLDFS 107
            H   +  +A     TFV +S  D  +    +R  +       +   +  + FS
Sbjct: 133 GHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFS 186


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
KOG0272|consensus459 99.8
KOG0271|consensus 480 99.8
KOG0263|consensus707 99.76
KOG0272|consensus459 99.76
KOG0286|consensus343 99.75
KOG0263|consensus707 99.74
KOG0266|consensus 456 99.73
KOG0276|consensus 794 99.71
KOG0271|consensus480 99.69
KOG0284|consensus 464 99.68
KOG0279|consensus 315 99.68
KOG0277|consensus311 99.67
KOG0279|consensus 315 99.66
KOG0315|consensus 311 99.66
KOG0319|consensus 775 99.66
KOG0285|consensus 460 99.65
KOG0286|consensus343 99.65
KOG0264|consensus422 99.64
KOG0302|consensus440 99.63
PTZ00421 493 coronin; Provisional 99.63
KOG0316|consensus 307 99.62
KOG0266|consensus 456 99.62
KOG0282|consensus 503 99.62
KOG0276|consensus 794 99.61
KOG0291|consensus 893 99.61
KOG0265|consensus 338 99.6
KOG0264|consensus422 99.58
KOG0284|consensus 464 99.58
KOG0292|consensus 1202 99.58
KOG0285|consensus 460 99.58
KOG0273|consensus524 99.58
KOG0319|consensus 775 99.57
KOG0281|consensus 499 99.57
KOG0302|consensus440 99.56
KOG0295|consensus406 99.56
PTZ00420 568 coronin; Provisional 99.55
KOG0277|consensus 311 99.55
KOG0273|consensus 524 99.53
KOG1034|consensus 385 99.53
KOG0281|consensus499 99.53
PTZ00420 568 coronin; Provisional 99.52
KOG0293|consensus519 99.51
KOG0291|consensus 893 99.51
KOG0647|consensus 347 99.5
KOG0269|consensus 839 99.5
PTZ00421 493 coronin; Provisional 99.49
KOG0278|consensus334 99.48
KOG0292|consensus 1202 99.48
KOG0303|consensus 472 99.47
KOG1446|consensus 311 99.46
KOG0310|consensus 487 99.46
KOG0772|consensus 641 99.46
KOG0313|consensus423 99.45
KOG0645|consensus 312 99.44
KOG0310|consensus 487 99.44
KOG0274|consensus 537 99.44
KOG0283|consensus 712 99.43
KOG0283|consensus 712 99.43
KOG0275|consensus 508 99.42
KOG0315|consensus311 99.42
KOG1063|consensus 764 99.41
KOG0295|consensus406 99.41
KOG0269|consensus 839 99.41
KOG0645|consensus 312 99.41
PLN00181 793 protein SPA1-RELATED; Provisional 99.4
KOG1446|consensus 311 99.4
KOG0294|consensus 362 99.39
KOG0313|consensus423 99.39
KOG0318|consensus 603 99.37
KOG0640|consensus 430 99.36
KOG0267|consensus 825 99.36
KOG0274|consensus 537 99.36
KOG0300|consensus481 99.36
KOG0282|consensus 503 99.36
KOG0275|consensus 508 99.36
KOG0316|consensus 307 99.35
KOG1445|consensus 1012 99.35
KOG0303|consensus 472 99.35
KOG1332|consensus 299 99.34
KOG0296|consensus 399 99.34
KOG0308|consensus 735 99.33
KOG0294|consensus 362 99.33
KOG0267|consensus 825 99.33
KOG0301|consensus 745 99.33
KOG4283|consensus397 99.32
KOG0643|consensus 327 99.3
KOG0270|consensus 463 99.3
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.3
KOG0308|consensus 735 99.3
KOG0643|consensus 327 99.29
KOG0642|consensus 577 99.28
KOG0973|consensus 942 99.27
KOG0289|consensus506 99.27
KOG0265|consensus 338 99.27
KOG1310|consensus 758 99.26
KOG0305|consensus484 99.26
KOG0270|consensus463 99.25
KOG2445|consensus 361 99.24
KOG0321|consensus 720 99.24
KOG1063|consensus764 99.24
KOG0268|consensus433 99.24
KOG0288|consensus 459 99.23
KOG0301|consensus 745 99.23
KOG0306|consensus 888 99.23
KOG0641|consensus350 99.22
KOG0293|consensus 519 99.22
KOG0318|consensus603 99.22
KOG0306|consensus 888 99.22
PLN00181793 protein SPA1-RELATED; Provisional 99.21
KOG0289|consensus 506 99.21
KOG0640|consensus 430 99.21
KOG1539|consensus 910 99.2
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.19
KOG0290|consensus364 99.19
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.18
KOG4328|consensus498 99.18
KOG0299|consensus479 99.18
KOG4283|consensus 397 99.17
KOG1009|consensus 434 99.16
KOG0646|consensus 476 99.16
KOG0305|consensus484 99.16
KOG0300|consensus 481 99.15
KOG0646|consensus 476 99.14
KOG0322|consensus323 99.13
KOG2110|consensus 391 99.12
KOG0639|consensus705 99.11
KOG1273|consensus 405 99.1
KOG0296|consensus 399 99.09
KOG0641|consensus 350 99.08
KOG1273|consensus 405 99.08
KOG1188|consensus 376 99.08
KOG1007|consensus370 99.07
KOG1407|consensus313 99.07
KOG2445|consensus 361 99.06
KOG2096|consensus420 99.05
KOG0299|consensus 479 99.05
KOG0278|consensus 334 99.05
KOG0307|consensus 1049 99.04
KOG0973|consensus 942 99.04
KOG1274|consensus 933 99.03
KOG0647|consensus 347 99.03
KOG2096|consensus420 99.02
KOG0639|consensus705 99.01
KOG2919|consensus406 98.99
KOG3914|consensus 390 98.98
KOG1036|consensus 323 98.98
KOG1036|consensus 323 98.97
KOG1445|consensus 1012 98.97
KOG0974|consensus 967 98.96
KOG0268|consensus 433 98.96
KOG1407|consensus 313 98.96
KOG1034|consensus385 98.95
KOG0321|consensus 720 98.94
KOG1539|consensus 910 98.92
KOG1007|consensus370 98.92
KOG0772|consensus 641 98.91
KOG0649|consensus325 98.9
KOG0288|consensus459 98.9
KOG0644|consensus 1113 98.89
KOG2394|consensus 636 98.88
KOG2111|consensus346 98.88
KOG1332|consensus 299 98.86
KOG0290|consensus 364 98.86
KOG4378|consensus 673 98.85
KOG0642|consensus 577 98.84
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.81
KOG0650|consensus 733 98.8
KOG2048|consensus 691 98.78
KOG2394|consensus 636 98.77
KOG0649|consensus 325 98.77
KOG4328|consensus 498 98.74
KOG0771|consensus 398 98.74
KOG2048|consensus 691 98.72
KOG1408|consensus 1080 98.68
KOG1408|consensus 1080 98.68
KOG1523|consensus 361 98.67
KOG1188|consensus 376 98.67
KOG1310|consensus 758 98.67
KOG1240|consensus 1431 98.65
KOG4378|consensus 673 98.65
KOG1272|consensus 545 98.64
KOG1538|consensus 1081 98.62
KOG0307|consensus 1049 98.61
KOG1524|consensus 737 98.57
KOG0644|consensus 1113 98.54
KOG0280|consensus339 98.53
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.5
KOG2106|consensus 626 98.47
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.44
KOG2055|consensus514 98.44
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.43
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.43
COG2319 466 FOG: WD40 repeat [General function prediction only 98.42
KOG4227|consensus 609 98.41
COG2319 466 FOG: WD40 repeat [General function prediction only 98.37
KOG1517|consensus1387 98.34
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.33
KOG1409|consensus 404 98.33
KOG0771|consensus 398 98.32
KOG1587|consensus555 98.31
KOG1587|consensus 555 98.3
KOG1274|consensus 933 98.3
KOG2919|consensus 406 98.24
KOG3881|consensus412 98.24
KOG1009|consensus 434 98.24
KOG0974|consensus 967 98.23
KOG1538|consensus 1081 98.23
KOG4227|consensus 609 98.19
KOG1517|consensus1387 98.18
KOG0322|consensus323 98.15
KOG0650|consensus733 98.07
KOG2321|consensus 703 98.07
KOG1963|consensus 792 98.05
KOG2106|consensus 626 98.04
KOG1523|consensus 361 98.03
KOG4714|consensus319 98.01
KOG2055|consensus 514 98.0
PRK01742 429 tolB translocation protein TolB; Provisional 98.0
KOG2139|consensus 445 97.98
KOG1064|consensus2439 97.95
KOG1963|consensus 792 97.91
KOG1409|consensus404 97.89
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.84
KOG2110|consensus 391 97.83
KOG1334|consensus 559 97.8
PRK05137 435 tolB translocation protein TolB; Provisional 97.77
KOG1272|consensus 545 97.76
KOG1524|consensus 737 97.74
KOG4714|consensus319 97.73
KOG4497|consensus 447 97.73
KOG0309|consensus 1081 97.69
PRK04922 433 tolB translocation protein TolB; Provisional 97.66
KOG2111|consensus 346 97.64
KOG2139|consensus 445 97.6
KOG1240|consensus 1431 97.58
KOG4190|consensus 1034 97.55
KOG2321|consensus 703 97.55
KOG2695|consensus425 97.4
PRK03629 429 tolB translocation protein TolB; Provisional 97.38
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.33
PRK01742429 tolB translocation protein TolB; Provisional 97.33
KOG2695|consensus425 97.28
PRK02889 427 tolB translocation protein TolB; Provisional 97.27
KOG4190|consensus 1034 97.22
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.22
KOG4547|consensus 541 97.21
KOG1334|consensus559 97.18
KOG4532|consensus344 97.11
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.02
KOG4547|consensus 541 96.99
KOG1064|consensus2439 96.96
KOG3881|consensus412 96.95
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 96.94
PRK00178 430 tolB translocation protein TolB; Provisional 96.93
KOG0309|consensus 1081 96.92
KOG1645|consensus 463 96.91
KOG4532|consensus344 96.9
PRK11028330 6-phosphogluconolactonase; Provisional 96.86
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.8
KOG1354|consensus433 96.74
KOG4640|consensus 665 96.68
KOG3914|consensus390 96.68
KOG1354|consensus 433 96.68
KOG0280|consensus 339 96.6
PRK05137435 tolB translocation protein TolB; Provisional 96.57
PRK11028 330 6-phosphogluconolactonase; Provisional 96.52
PRK03629429 tolB translocation protein TolB; Provisional 96.38
PRK04922433 tolB translocation protein TolB; Provisional 96.36
PRK02889427 tolB translocation protein TolB; Provisional 96.26
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.24
PRK04792 448 tolB translocation protein TolB; Provisional 96.23
KOG4640|consensus 665 96.02
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 95.82
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.53
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.44
KOG3617|consensus 1416 95.27
KOG2315|consensus 566 95.22
KOG2041|consensus 1189 94.97
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 94.92
KOG2066|consensus 846 94.63
KOG2079|consensus 1206 94.63
KOG1912|consensus 1062 94.58
KOG2041|consensus 1189 94.52
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.35
KOG1832|consensus 1516 94.33
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.33
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 94.31
KOG1275|consensus 1118 94.18
KOG4497|consensus 447 94.01
PRK00178430 tolB translocation protein TolB; Provisional 93.8
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 93.76
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.72
KOG2315|consensus 566 93.38
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.31
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 92.83
PRK01029428 tolB translocation protein TolB; Provisional 92.82
PRK04792448 tolB translocation protein TolB; Provisional 92.7
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.39
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 92.16
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 92.05
KOG1275|consensus 1118 91.76
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.7
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 90.57
KOG2314|consensus 698 90.49
PRK01029428 tolB translocation protein TolB; Provisional 90.44
KOG1645|consensus 463 90.31
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 89.58
KOG2395|consensus 644 89.55
KOG1008|consensus 783 88.9
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.83
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 88.52
KOG3621|consensus 726 88.48
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 88.44
KOG3621|consensus 726 88.26
KOG3617|consensus 1416 88.02
KOG2066|consensus 846 87.9
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 87.69
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 87.68
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 87.18
KOG0882|consensus 558 86.79
KOG0882|consensus 558 86.32
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 85.57
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 85.44
KOG2079|consensus 1206 83.41
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 82.05
KOG2444|consensus238 81.44
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 81.35
KOG1008|consensus 783 81.18
>KOG0272|consensus Back     alignment and domain information
Probab=99.80  E-value=7.7e-20  Score=116.26  Aligned_cols=111  Identities=15%  Similarity=0.250  Sum_probs=87.4

Q ss_pred             eeeec---ccCeEEcCCCCCeeEEEECCCCCEEEEEeCCCcEEEecCCCCceeeEecCcceEeccccEEEEEcc-CcEEE
Q psy15190          2 LVWAQ---QPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALIS-TFVFA   77 (117)
Q Consensus         2 ~~w~~---~~~~~~~~h~~~v~~i~~~~~~~~~~s~~~d~~~~~wd~~~~~~~~~~~~~~~~~~~~i~~~~~~~-~~~~~   77 (117)
                      ++||+   .......||...|.+++|+|+|.+++||+.|..-||||+++++    ...-..+|..+|..++|+| +.+++
T Consensus       286 RlWD~~tk~ElL~QEGHs~~v~~iaf~~DGSL~~tGGlD~~~RvWDlRtgr----~im~L~gH~k~I~~V~fsPNGy~lA  361 (459)
T KOG0272|consen  286 RLWDLETKSELLLQEGHSKGVFSIAFQPDGSLAATGGLDSLGRVWDLRTGR----CIMFLAGHIKEILSVAFSPNGYHLA  361 (459)
T ss_pred             hhcccccchhhHhhcccccccceeEecCCCceeeccCccchhheeecccCc----EEEEecccccceeeEeECCCceEEe
Confidence            58999   4455667999999999999999999999999999999999998    2323346889999999999 45799


Q ss_pred             EecCCCeEEEeeCChh-----HHHhhhhhcCCCcccCCceeeEe
Q psy15190         78 SGADEKVVRAFRTTQN-----FVDNIQRLCGLDFSQHPTNILFT  116 (117)
Q Consensus        78 s~~~d~~i~iw~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~  116 (117)
                      ||+.|++++|||+++.     -.++.+.++...+.+...+.+.|
T Consensus       362 Tgs~Dnt~kVWDLR~r~~ly~ipAH~nlVS~Vk~~p~~g~fL~T  405 (459)
T KOG0272|consen  362 TGSSDNTCKVWDLRMRSELYTIPAHSNLVSQVKYSPQEGYFLVT  405 (459)
T ss_pred             ecCCCCcEEEeeecccccceecccccchhhheEecccCCeEEEE
Confidence            9999999999999754     13344455556666545555444



>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.76
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.73
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.72
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.71
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.71
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.71
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.71
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.7
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.7
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.7
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.69
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.69
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.69
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.69
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.68
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.68
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.67
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.66
2pm7_B 297 Protein transport protein SEC13, protein transport 99.65
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.65
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.64
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.63
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.63
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 99.63
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.63
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.62
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.62
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.62
2pm7_B 297 Protein transport protein SEC13, protein transport 99.61
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.61
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.61
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.6
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.6
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.6
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.59
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.59
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.58
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.58
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.58
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.58
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.58
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.58
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.58
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.58
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.58
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.57
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.57
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.56
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.56
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.55
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.55
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.55
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.55
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.54
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.54
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.54
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.54
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.53
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.53
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.52
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.52
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.52
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.52
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.52
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.52
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.51
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.5
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.5
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.5
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.49
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.49
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.49
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.49
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.49
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.48
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.47
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.47
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.47
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.47
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.46
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.46
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.46
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.46
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.45
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.45
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.44
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.44
3jro_A 753 Fusion protein of protein transport protein SEC13 99.44
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.44
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.44
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.44
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.44
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.43
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.43
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.43
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.42
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.42
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.42
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.42
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.41
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.41
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.4
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.4
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.39
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.39
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.39
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.38
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.38
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.38
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.37
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.37
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.35
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.35
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.35
3jro_A 753 Fusion protein of protein transport protein SEC13 99.34
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.33
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.32
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.32
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.32
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.32
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.27
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.1
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.08
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.08
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.05
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.88
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.85
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.73
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.66
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.64
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.52
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.51
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.47
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.42
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.38
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.38
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.35
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.34
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.33
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.31
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.3
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.29
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.28
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.27
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.24
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.18
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.16
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.14
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.13
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.1
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.09
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.06
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.05
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.04
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.98
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 97.94
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.92
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.89
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.82
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.78
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.76
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.68
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.62
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.56
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 97.53
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.52
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.47
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.41
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.36
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.32
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.29
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.25
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.23
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.18
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.17
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.05
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.02
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.94
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.94
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 96.91
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.9
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.89
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 96.86
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.85
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.67
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.46
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 96.44
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.44
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.33
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.16
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 96.11
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.1
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.94
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.88
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 95.79
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.75
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 95.04
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.89
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 94.83
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.41
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.35
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 93.94
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 93.74
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 93.61
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 93.58
2qe8_A 343 Uncharacterized protein; structural genomics, join 93.3
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 93.25
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.68
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 92.24
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 91.56
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 91.54
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 91.32
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 91.24
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 91.18
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 91.11
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 90.35
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 89.84
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 89.26
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 88.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 88.64
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 88.4
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 87.86
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 87.21
2qe8_A 343 Uncharacterized protein; structural genomics, join 85.2
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 84.18
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 83.99
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 83.23
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 82.12
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 82.06
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 81.42
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 80.08
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=99.76  E-value=6.5e-18  Score=107.76  Aligned_cols=89  Identities=18%  Similarity=0.192  Sum_probs=73.5

Q ss_pred             Ceeeec---ccC----eEEcCCCCCeeEEEECCCCCEEEEEeCCCcEEEecCCCCceeeEecCcceEeccccEEEEEccC
Q psy15190          1 MLVWAQ---QPC----VTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLTCLALIST   73 (117)
Q Consensus         1 v~~w~~---~~~----~~~~~h~~~v~~i~~~~~~~~~~s~~~d~~~~~wd~~~~~~~~~~~~~~~~~~~~i~~~~~~~~   73 (117)
                      |++||+   +..    ..+.+|.+.|.+++|+|+++++++++.|+++++||+.++.    +......|...|.++++.++
T Consensus       105 v~lWd~~~~~~~~~~~~~~~~H~~~V~~v~~spdg~~l~sgs~d~~i~iwd~~~~~----~~~~~~~h~~~V~~~~~~~~  180 (344)
T 4gqb_B          105 VELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQV----VLSSYRAHAAQVTCVAASPH  180 (344)
T ss_dssp             EEEEEECTTSSCEEEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE----EEEEECCCSSCEEEEEECSS
T ss_pred             EEEEeccCCCceeEeeccccCCCCCEEEEEECCCCCEEEEEeCCCeEEEEECCCCc----EEEEEcCcCCceEEEEecCC
Confidence            589998   222    3345899999999999999999999999999999998776    23334468889999998874


Q ss_pred             --cEEEEecCCCeEEEeeCChh
Q psy15190         74 --FVFASGADEKVVRAFRTTQN   93 (117)
Q Consensus        74 --~~~~s~~~d~~i~iw~~~~~   93 (117)
                        .++++++.|++|++||++.+
T Consensus       181 ~~~~l~s~s~D~~v~iwd~~~~  202 (344)
T 4gqb_B          181 KDSVFLSCSEDNRILLWDTRCP  202 (344)
T ss_dssp             CTTEEEEEETTSCEEEEETTSS
T ss_pred             CCCceeeecccccccccccccc
Confidence              47899999999999999653



>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-04
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.002
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.004
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 38.6 bits (88), Expect = 5e-05
 Identities = 16/112 (14%), Positives = 29/112 (25%), Gaps = 4/112 (3%)

Query: 7   QPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQTTRLHAPFVGKNTWYEMARPQVHGYDLT 66
               T  GH   +  I + P+G    + S+D T RL      +          + G    
Sbjct: 217 MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSV 276

Query: 67  CLALISTFVFASGADEKV----VRAFRTTQNFVDNIQRLCGLDFSQHPTNIL 114
             +     + A   D                   +  R+  L  +     + 
Sbjct: 277 SFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVA 328


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.75
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.7
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.62
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.62
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.61
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.61
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.6
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.6
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.6
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.59
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.59
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.59
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.58
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.57
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.56
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.53
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.5
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.5
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.48
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.48
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.47
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.46
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.46
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.4
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.39
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.36
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.2
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.19
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.18
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.18
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.13
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.72
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.49
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.49
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.43
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.4
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.38
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.26
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.19
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.1
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.82
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.82
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.65
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.63
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.48
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.4
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.38
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.96
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.35
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 95.24
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 93.6
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.44
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.51
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 90.49
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 89.36
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 83.28
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 82.54
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 80.19
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.75  E-value=4.3e-18  Score=108.14  Aligned_cols=103  Identities=11%  Similarity=0.123  Sum_probs=75.8

Q ss_pred             Ceeeec---------ccCeEEcCCCCCeeEEEECCCCCEEEEEeCCCc---EEEecCCCCceeeE---------ecCcce
Q psy15190          1 MLVWAQ---------QPCVTVGGHFGPVRDIQWEPSGQFIISVSEDQT---TRLHAPFVGKNTWY---------EMARPQ   59 (117)
Q Consensus         1 v~~w~~---------~~~~~~~~h~~~v~~i~~~~~~~~~~s~~~d~~---~~~wd~~~~~~~~~---------~~~~~~   59 (117)
                      |++||+         +....+.+|...|.+++|+|+++++++++.|++   +++||+..+.....         ......
T Consensus       207 i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~g~~~~~l~~~~~~~~~~~~~~  286 (393)
T d1sq9a_         207 VQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEF  286 (393)
T ss_dssp             EEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTTCCEEEEECBC--------CCB
T ss_pred             EEEEeecccccccccccccccccccceEEEcccccccceeeeecCCCCcceeeecccccceeeeeeccccccccceeeee
Confidence            578998         233456689999999999999999999999975   89999987652111         111234


Q ss_pred             EeccccEEEEEccC-cEEEEecCCCeEEEeeCChhHHHhhhhhcCCC
Q psy15190         60 VHGYDLTCLALIST-FVFASGADEKVVRAFRTTQNFVDNIQRLCGLD  105 (117)
Q Consensus        60 ~~~~~i~~~~~~~~-~~~~s~~~d~~i~iw~~~~~~~~~~~~~~~~~  105 (117)
                      +|...|.+++++++ ..+++|+.|++|++||+.++  +....+.+|.
T Consensus       287 gH~~~V~~l~fspd~~~l~S~s~D~~v~vWd~~~g--~~~~~l~gH~  331 (393)
T d1sq9a_         287 AHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTK--ERITTLNMHC  331 (393)
T ss_dssp             SBSSCEEEEEECSSSSEEEEEETTSEEEEEETTTT--EEEEEEECCG
T ss_pred             cccCceeeeccCCCCCeeEEECCCCEEEEEECCCC--CEEEEECCcC
Confidence            57888999999884 57999999999999999765  4444455543



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure