Diaphorina citri psyllid: psy151


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MSSLNKLLSEDSDSKPRPWVLDISGVVVGVTSVDVLMHLGREEFAAAPEMTDRLSRLASHLLQQQCYYPLIPPNVELPVDMECWELHAQLPVTPHIMILPSDLRYFVKAL
ccccccccccccCECccccEEEEccEEEEEEcHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccccEEEEcccccccEEEc
*********EDSDSKPRPWVLDISGVVVGVTSVDVLMHLGREEFAAAPEMTDRLSRLASHLLQQQCYYPLIPPNVELPVDMECWELHAQLPVTPHIMILPSDLRYFVKAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLNKLLSEDSDSKPRPWVLDISGVVVGVTSVDVLMHLGREEFAAAPEMTDRLSRLASHLLQQQCYYPLIPPNVELPVDMECWELHAQLPVTPHIMILPSDLRYFVKAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase alpha subunit B May play an essential role at the early stage of chromosomal DNA replication by coupling the polymerase alpha/primase complex to the cellular replication machinery.confidentQ14181

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FLO, chain A
Confidence level:very confident
Coverage over the Query: 5-110
View the alignment between query and template
View the model in PyMOL