Diaphorina citri psyllid: psy15201

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MFWADGGKSAVSGVNQLGVVINKLDTVSWSQDRFQEIVTKLGAFLKQAGFRDSDIEYVPCSGLTGENLTTPSQVPALTSWYSGPCLLDVIGLSGLSL
cccccccCEEEccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccCEEEcccccccccccccccccccccccccHHHHHHccccccc
*****GGKSAVSGVNQLGVVINKLDTVSWSQDRFQEIVTKLGAFLKQAGFRDSDIEYVPCSGLTGENLTTPSQVPALTSWYSGPCLLDVIGLSG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWADGGKSAVSGVNQLGVVINKLDTVSWSQDRFQEIVTKLGAFLKQAGFRDSDIEYVPCSGLTGENLTTPSQVPALTSWYSGPCLLDVIGLSGLSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
HBS1-like protein confidentQ69ZS7
HBS1-like protein confidentQ6AXM7
HBS1-like protein confidentQ2KHZ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032550 [MF]purine ribonucleoside bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:1901363, GO:0001883, GO:0001882
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0032561 [MF]guanyl ribonucleotide bindingprobableGO:0097159, GO:0000166, GO:0036094, GO:0019001, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:1901363, GO:1901265, GO:0005488
GO:0043933 [BP]macromolecular complex subunit organizationprobableGO:0008150, GO:0071840, GO:0016043
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R5B, chain A
Confidence level:very confident
Coverage over the Query: 9-95
View the alignment between query and template
View the model in PyMOL