Diaphorina citri psyllid: psy15204

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPVSRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS
ccEEEEcccCEEEEcccEEEEECccCEEEEcccccCEEECcccccccccccccccccccccccccccccEEEECccccccccccccccccccCCcccccccccccccccccccCEEEEEEEEccccccccccccEEEEEEEEcEEEEEHHHHHHHHHcccccEEcccccEEEcccEEEEEEEEcccEEEEEccccccccEEEEEEcccEEEEEEEEEEEEcccccccEEEcc
*LFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDV***************TSGFAVPECIPTKTPTQKKL*******************************SPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIR***RALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTN*Y***
xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPVSRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F60, chain A
Confidence level:very confident
Coverage over the Query: 18-65,91-220
View the alignment between query and template
View the model in PyMOL