Psyllid ID: psy15204

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPVSRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS
ccEEEEcccEEEEEcccEEEEEEccEEEEEcccccEEEEEcccccccccccccccccccccccccccccEEEEEccccccccccccccccccEEcccccccccccccccccccEEEEEEEEEccccccccccccEEEEEEEEcEEEEEHHHHHHHHHcccccEEcccccEEEcccEEEEEEEEcccEEEEEccccccccEEEEEEcccEEEEEEEEEEEEcccccccEEEcc
ccEEEEccccEEcHHHHHHHHcccccEEEEccccccEEEcccHHHHHHHHHccccccccccccccccccEHHccccccccccccccccccccccccccccEccccccccHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHccccccHcccccEEccccEEEEEEccccccEEcccccccccccHHHHccHHHEEEEEEEEEEccccccccEEEcc
mlfaqinsgfllsWSSWIclfiipkltiiisdanvktdvssnpsasaadqsfpdtsgfavpeciptktptqkklgpssstpvtprsqspstpvsrsrspatptctsptpdqepsrsvklvklsNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDqcgstnlynis
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPtktptqkklgpssstpvtprsqspstpvsrsrspatptctsptpdqepsrsvklVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSqvhktsgevirkkpraltksmsaqvvietVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVifdqcgstnlynis
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKLGpssstpvtprsqspstpvsrsrspatptctsptpDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS
**FAQINSGFLLSWSSWICLFIIPKLTIIISDANV**********************************************************************************KLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIR*****LTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLY***
*L*A**NSGFLLSWSSWICLFIIPKLTIIISDANVKTDV***************TSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPVSRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHK**********RALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQC*****Y***
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVK*****************DTSGFAVPECIPTKT***********************************************SVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKL*******************************SPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFAQINSGFLLSWSSWICLFIIPKLTIIISDANVKTDVSSNPSASAADQSFPDTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPVSRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFDQCGSTNLYNIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q9Y450684 HBS1-like protein OS=Homo yes N/A 0.349 0.118 0.543 4e-20
Q5R6Y0684 HBS1-like protein OS=Pong yes N/A 0.349 0.118 0.543 7e-20
Q2KHZ2686 HBS1-like protein OS=Bos yes N/A 0.349 0.118 0.555 1e-15
Q6AXM7679 HBS1-like protein OS=Ratt yes N/A 0.396 0.135 0.5 5e-15
Q69ZS7682 HBS1-like protein OS=Mus yes N/A 0.396 0.134 0.5 5e-15
Q9HGI8700 Eukaryotic peptide chain yes N/A 0.478 0.158 0.378 7e-12
Q9HGI4662 Eukaryotic peptide chain no N/A 0.426 0.149 0.388 2e-11
P05453685 Eukaryotic peptide chain yes N/A 0.422 0.143 0.362 5e-10
P23637741 Eukaryotic peptide chain N/A N/A 0.426 0.133 0.339 1e-09
Q9HGI7712 Eukaryotic peptide chain N/A N/A 0.491 0.160 0.303 6e-08
>sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 65/81 (80%)

Query: 138 MHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKE 197
           +H Q+++E AVI RL+S ++K++GEV +KKP+ LTK  +A V ++T RP+ +ELY+D KE
Sbjct: 602 LHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKFLTKGQNALVELQTQRPIALELYKDFKE 661

Query: 198 LGRFMLRVSGVTIAAGLITKV 218
           LGRFMLR  G TIAAG++T++
Sbjct: 662 LGRFMLRYGGSTIAAGVVTEI 682

Homo sapiens (taxid: 9606)
>sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 Back     alignment and function description
>sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 Back     alignment and function description
>sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=2 SV=1 Back     alignment and function description
>sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 Back     alignment and function description
>sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 Back     alignment and function description
>sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 Back     alignment and function description
>sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 Back     alignment and function description
>sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 Back     alignment and function description
>sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
321470302 472 hypothetical protein DAPPUDRAFT_303602 [ 0.495 0.243 0.508 2e-23
383858583 983 PREDICTED: HBS1-like protein-like [Megac 0.396 0.093 0.576 4e-23
242004570 411 conserved hypothetical protein [Pediculu 0.353 0.199 0.609 1e-22
307194250 949 HBS1-like protein [Harpegnathos saltator 0.379 0.092 0.568 2e-22
332031681 547 HBS1-like protein [Acromyrmex echinatior 0.379 0.160 0.579 3e-22
307167810 746 HBS1-like protein [Camponotus floridanus 0.379 0.117 0.568 4e-22
322785960 653 hypothetical protein SINV_01502 [Solenop 0.379 0.134 0.579 5e-22
340369803 1031 PREDICTED: hypothetical protein LOC10063 0.353 0.079 0.670 5e-22
340716136 978 PREDICTED: HBS1-like protein-like [Bombu 0.396 0.094 0.554 1e-21
91079704 792 PREDICTED: similar to eukaryotic peptide 0.383 0.112 0.573 1e-21
>gi|321470302|gb|EFX81279.1| hypothetical protein DAPPUDRAFT_303602 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 80/116 (68%), Gaps = 1/116 (0%)

Query: 104 CTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEV 163
           C    P +  SR    V + NV  +   K   V +H QSL+E+A IT+L++Q+HK++GEV
Sbjct: 358 CDPSQPIKVTSRIQARVVIFNV-DIPITKGYPVVIHYQSLSEAATITKLIAQIHKSTGEV 416

Query: 164 IRKKPRALTKSMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVI 219
           IRK+PR LTK  S  V IE  RP+C+ELY+D +ELGRFM+R SG TIAAGL+T ++
Sbjct: 417 IRKRPRCLTKQTSGLVEIEISRPICMELYKDYRELGRFMIRASGTTIAAGLVTSIM 472

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383858583|ref|XP_003704780.1| PREDICTED: HBS1-like protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242004570|ref|XP_002423155.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506112|gb|EEB10417.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307194250|gb|EFN76647.1| HBS1-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332031681|gb|EGI71126.1| HBS1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307167810|gb|EFN61251.1| HBS1-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322785960|gb|EFZ12576.1| hypothetical protein SINV_01502 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340369803|ref|XP_003383437.1| PREDICTED: hypothetical protein LOC100638160 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|340716136|ref|XP_003396557.1| PREDICTED: HBS1-like protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91079704|ref|XP_968959.1| PREDICTED: similar to eukaryotic peptide chain release factor GTP-binding subunit [Tribolium castaneum] gi|270004497|gb|EFA00945.1| hypothetical protein TcasGA2_TC003854 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
UNIPROTKB|F1N1V0686 HBS1L "HBS1-like protein" [Bos 0.422 0.142 0.484 2.8e-21
UNIPROTKB|Q2KHZ2686 HBS1L "HBS1-like protein" [Bos 0.422 0.142 0.484 2.8e-21
UNIPROTKB|E2QZR6685 HBS1L "Uncharacterized protein 0.422 0.143 0.484 7.3e-21
FB|FBgn0042712670 HBS1 "HBS1" [Drosophila melano 0.349 0.120 0.567 2.4e-20
UNIPROTKB|E1BW59688 HBS1L "Uncharacterized protein 0.422 0.142 0.494 8.6e-20
UNIPROTKB|B7Z1K2408 HBS1L "HBS1-like protein" [Hom 0.422 0.240 0.474 8.8e-20
UNIPROTKB|F1S3R5686 HBS1L "Uncharacterized protein 0.422 0.142 0.484 1.8e-19
UNIPROTKB|B7Z524520 HBS1L "HBS1-like protein" [Hom 0.422 0.188 0.474 2e-19
UNIPROTKB|H0YDX7554 HBS1L "HBS1-like protein" [Hom 0.422 0.176 0.474 2.4e-19
RGD|1308509679 Hbs1l "Hbs1-like (S. cerevisia 0.422 0.144 0.474 2.9e-19
UNIPROTKB|F1N1V0 HBS1L "HBS1-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 244 (91.0 bits), Expect = 2.8e-21, Sum P(2) = 2.8e-21
 Identities = 48/99 (48%), Positives = 74/99 (74%)

Query:   120 VKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQV 179
             + + N+ ++   K   V +H Q+++E AVI RL+S ++K++GEV +KKP+ LTK  +A V
Sbjct:   587 ILIFNI-EIPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKLLTKGQNALV 645

Query:   180 VIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKV 218
              ++T RP+ +ELY+D KELGRFMLR SG TIAAG++T++
Sbjct:   646 ELQTQRPVALELYKDFKELGRFMLRYSGSTIAAGVVTEI 684
GO:0005525 "GTP binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
UNIPROTKB|Q2KHZ2 HBS1L "HBS1-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZR6 HBS1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0042712 HBS1 "HBS1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW59 HBS1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z1K2 HBS1L "HBS1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3R5 HBS1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z524 HBS1L "HBS1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDX7 HBS1L "HBS1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308509 Hbs1l "Hbs1-like (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd04093107 cd04093, HBS1_C, HBS1_C: this family represents th 1e-30
cd03704108 cd03704, eRF3c_III, This family represents eEF1alp 9e-17
cd03705104 cd03705, EF1_alpha_III, Domain III of EF-1 2e-12
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 2e-12
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 2e-10
cd01513102 cd01513, Translation_factor_III, Domain III of Elo 2e-09
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 7e-09
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 3e-08
pfam0314391 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-ter 2e-05
cd04095103 cd04095, CysN_NoDQ_III, TCysN_NoDQ_II: This subfam 2e-05
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 9e-05
>gnl|CDD|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information 
 Score =  108 bits (273), Expect = 1e-30
 Identities = 43/81 (53%), Positives = 60/81 (74%)

Query: 138 MHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKE 197
           + + SL E A IT+L+S + K++GEV +KKPR LTK  +A V IE  RP+ +EL++D KE
Sbjct: 27  LFRHSLKEPATITKLVSILDKSTGEVSKKKPRCLTKGQTAIVEIELERPIPLELFKDNKE 86

Query: 198 LGRFMLRVSGVTIAAGLITKV 218
           LGR +LR  G TIAAGL+T++
Sbjct: 87  LGRVVLRRDGETIAAGLVTEI 107

This group contains proteins similar to yeast Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation and, to associate with Dom34. It has been speculated that yeast Hbs1 and Dom34 proteins may function as part of a complex with a role in gene expression. Length = 107
>gnl|CDD|239675 cd03704, eRF3c_III, This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>gnl|CDD|239676 cd03705, EF1_alpha_III, Domain III of EF-1 Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|238771 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|217387 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain Back     alignment and domain information
>gnl|CDD|239762 cd04095, CysN_NoDQ_III, TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
PLN00043447 elongation factor 1-alpha; Provisional 99.98
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.97
PRK12317425 elongation factor 1-alpha; Reviewed 99.97
PTZ00141446 elongation factor 1- alpha; Provisional 99.97
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 99.95
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 99.95
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 99.94
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.94
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.94
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.94
KOG0052|consensus391 99.94
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 99.92
KOG0459|consensus501 99.91
cd01513102 Translation_factor_III Domain III of Elongation fa 99.89
PLN03126478 Elongation factor Tu; Provisional 99.89
PRK00049396 elongation factor Tu; Reviewed 99.88
CHL00071409 tufA elongation factor Tu 99.88
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 99.88
PLN03127447 Elongation factor Tu; Provisional 99.87
PRK12735396 elongation factor Tu; Reviewed 99.87
PRK12736394 elongation factor Tu; Reviewed 99.87
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.86
COG0050394 TufB GTPases - translation elongation factors [Tra 99.86
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.85
KOG0460|consensus449 99.84
KOG0458|consensus603 99.75
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 99.74
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.69
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.67
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.61
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.56
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.54
cd0409497 selB_III This family represents the domain of elon 99.47
COG5258527 GTPBP1 GTPase [General function prediction only] 99.45
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.44
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.27
KOG0463|consensus641 98.63
KOG1143|consensus591 98.26
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 98.03
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.95
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 97.93
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.91
COG3276447 SelB Selenocysteine-specific translation elongatio 97.73
cd0369683 selB_II selB_II: this subfamily represents the dom 97.68
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 97.66
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.39
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 93.21
PF0917388 eIF2_C: Initiation factor eIF2 gamma, C terminal; 93.1
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 92.2
COG5257415 GCD11 Translation initiation factor 2, gamma subun 90.48
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=5.4e-34  Score=268.35  Aligned_cols=174  Identities=26%  Similarity=0.352  Sum_probs=157.6

Q ss_pred             heeeeeecCCeEEEEecCceeeeccccccc-ccccccCC-CCcccccCcccCCCCccccccCCCCCCCCCCCCCCCCccc
Q psy15204         16 SWICLFIIPKLTIIISDANVKTDVSSNPSA-SAADQSFP-DTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPV   93 (232)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v   93 (232)
                      .=+++.|+||++|.|.|+++.+||+|++|| +.++++.| ||+|||||++..      .++++|.   |-+.+.      
T Consensus       252 rVEsG~i~~g~~v~~~p~~~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~------~dI~~Gd---v~~~~~------  316 (428)
T COG5256         252 RVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEK------NDIRRGD---VIGHSD------  316 (428)
T ss_pred             EEeeeeeccCCEEEEecCcceEEEeeeeecccccccCCCCCeEEEEecCCch------hccCCcc---EeccCC------
Confidence            568999999999999999999999999997 69999999 999999999954      5777776   655554      


Q ss_pred             ccccccccCCccCCCCCCCCcceEEEEEEeCCCccCcCCCCeEEEEEecceEEEEEEEeeeecccCccceeccCCcccCC
Q psy15204         94 SRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTK  173 (232)
Q Consensus        94 ~rg~v~a~p~~~~~~p~~~as~~a~Iv~L~~e~~~PI~~Gy~p~Lh~~T~~v~~rI~kI~~kIDk~Tg~~~kk~pk~Lk~  173 (232)
                                   ..|.....|.++|.+|  +|+.+|.+||+++||+|++.++|++.+|.+++|+.||+..+++|.+++.
T Consensus       317 -------------n~~t~s~~f~a~i~vl--~~p~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~t~k~~~~~p~f~k~  381 (428)
T COG5256         317 -------------NPPTVSPEFTAQIIVL--WHPGIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKR  381 (428)
T ss_pred             -------------CCcccccceEEEEEEE--ecCccccCCCccEEEecccceeeeHHHHHHhhCcccccccccChhhhhc
Confidence                         2233334677788888  5899999999999999999999999999999999999998999999999


Q ss_pred             CCeeEEEEEeCceEEeeeccCCCceeeEEEEECCCeEEEEEEEEee
Q psy15204        174 SMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVI  219 (232)
Q Consensus       174 GD~A~V~I~l~kPI~vE~fs~~p~LGRFiLRD~g~TVAaGiI~~V~  219 (232)
                      ||.++|+|++.+|+|+|.++++++||||+|||+|+|||+|+|.++.
T Consensus       382 g~~~iv~i~~~kP~~~e~~~~~~~Lgrfalrd~g~tIA~G~v~~v~  427 (428)
T COG5256         382 GDAAIVKIEPEKPLCLEKVSEIPQLGRFALRDMGQTIAAGKVLEVK  427 (428)
T ss_pred             CceEEEEEEecCceEeeecccCCccceEEEEeCCCeEEeEEEEecc
Confidence            9999999999999999999999999999999999999999999874

>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3j2k_7439 Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ 2e-08
3e20_A201 Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Lengt 4e-08
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 4e-08
3e1y_E204 Crystal Structure Of Human Erf1ERF3 COMPLEX Length 9e-08
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 5e-07
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 8e-06
3vmf_A440 Archaeal Protein Length = 440 8e-06
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 2e-04
>pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%)
Query: 138 MHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKE 197
           +H  +  E   IT L+S V K SGE  + +PR + +       + T   +C+E ++D  +
Sbjct: 357 LHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQ 416
Query: 198 LGRFMLRVSGVTIAAGLITKVI 219
           +GRF LR  G TIA G + K++
Sbjct: 417 MGRFTLRDEGKTIAIGKVLKLV 438
>pdb|3E20|A Chain A, Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Length = 201 Back     alignment and structure
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure
>pdb|3E1Y|E Chain E, Crystal Structure Of Human Erf1ERF3 COMPLEX Length = 204 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 1e-25
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 2e-25
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 3e-25
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 1e-22
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 2e-22
1f60_A458 Elongation factor EEF1A; protein-protein complex, 6e-22
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 1e-16
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 2e-06
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
 Score =  102 bits (257), Expect = 1e-25
 Identities = 24/82 (29%), Positives = 45/82 (54%)

Query: 138 MHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKE 197
           +H  + + +  ++ L+S++   +G+   K P+ L +   A V  + ++P+CVE Y +   
Sbjct: 347 LHVHTASVACRVSELVSKLDPRTGQEAEKNPQFLKQGDVAIVKFKPIKPLCVEKYNEFPP 406

Query: 198 LGRFMLRVSGVTIAAGLITKVI 219
           LGRF +R  G T+  G+I  V 
Sbjct: 407 LGRFAMRDMGKTVGVGIIVDVK 428
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.97
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.97
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.96
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.96
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.95
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.94
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.94
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.88
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.87
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.84
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.81
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.8
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.69
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.66
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.53
1xe1_A116 Hypothetical protein PF0907; structural genomics, 98.01
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=9.7e-37  Score=261.21  Aligned_cols=176  Identities=19%  Similarity=0.249  Sum_probs=158.8

Q ss_pred             heeeeeecCCeEEEEecCceeeeccccccc-ccccccCC-CCcccccCcccCCCCccccccCCCCCCCCCCCCCCCCccc
Q psy15204         16 SWICLFIIPKLTIIISDANVKTDVSSNPSA-SAADQSFP-DTSGFAVPECIPTKTPTQKKLGPSSSTPVTPRSQSPSTPV   93 (232)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v   93 (232)
                      ..+.+.+++||.|.|.|.+.++.|+|++|| +.+++|.| |++||+++++..                         .-|
T Consensus        25 ~v~~G~i~~Gd~v~i~P~~~~~~V~~I~~~~~~~~~A~aGd~V~l~L~gi~~-------------------------~di   79 (204)
T 3e1y_E           25 KLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEE-------------------------EEI   79 (204)
T ss_dssp             ECCBSCEESSCCEEETTTTEEEEEEEECSSSSCBSEECTTSEEEEEEEESSS-------------------------SCC
T ss_pred             EEecCEEECCCEEEECCCCCEEEEEEEEECCEEeEEECCCCEEEEEEcCCCH-------------------------HHC
Confidence            345788999999999999999999999997 69999999 999999998732                         136


Q ss_pred             ccccccccCCccCCCCCCCCcceEEEEEEeCCCccCcCCCCeEEEEEecceEEEEEEEeeeecccCccceeccCCcccCC
Q psy15204         94 SRSRSPATPTCTSPTPDQEPSRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTK  173 (232)
Q Consensus        94 ~rg~v~a~p~~~~~~p~~~as~~a~Iv~L~~e~~~PI~~Gy~p~Lh~~T~~v~~rI~kI~~kIDk~Tg~~~kk~pk~Lk~  173 (232)
                      +||++++.|+.   .|.....|+++++||  +++.||.+||+|+||+||.+++|+|.+|.+++|++||+..++++++|++
T Consensus        80 ~rG~vl~~~~~---~~~~~~~f~a~v~~l--~~~~~i~~g~~~~l~~~t~~~~~~i~~i~~~id~~tg~~~~~~~~~l~~  154 (204)
T 3e1y_E           80 LPGFILCDPNN---LCHSGRTFDAQIVII--EHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQ  154 (204)
T ss_dssp             CTTCEEBCSSS---CCCCCSEEEEEEECC--SCCSCCCTTEEEEEESSSCEEEEEEEEECCCCCSSTTCCCSSCCSCCCT
T ss_pred             ccceEEECCCC---CCchhEEEEEEEEEe--CCCCccCCCceEEEEEeCCEEEEEEEEEEEEEcCCCCCEeccCCcCcCC
Confidence            78999999864   245556789999999  4677999999999999999999999999999999999887778999999


Q ss_pred             CCeeEEEEEeCceEEeeeccCCCceeeEEEEECCCeEEEEEEEEeeec
Q psy15204        174 SMSAQVVIETVRPMCVELYRDVKELGRFMLRVSGVTIAAGLITKVIFD  221 (232)
Q Consensus       174 GD~A~V~I~l~kPI~vE~fs~~p~LGRFiLRD~g~TVAaGiI~~V~~k  221 (232)
                      ||.|.|+|++.+|+|+|+|++++.+|||+|||+|+|||+|+|+++.+.
T Consensus       155 gd~a~v~l~~~~pi~~e~~~~~~~~Grfilrd~~~Tva~G~V~~v~~~  202 (204)
T 3e1y_E          155 DQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPE  202 (204)
T ss_dssp             TCEEEEEEEESSCCCCCCTTSSGGGTEEEEECSSSCCEEEEEEEECC-
T ss_pred             CCEEEEEEEECCeEEEEEcccCcCCCCEEEEECCcEEEEEEEEEEecC
Confidence            999999999999999999999999999999999999999999998764
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1f60a2107 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, 2e-17
d1jnya2107 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, 1e-13
d1zunb2105 b.44.1.1 (B:330-434) Sulfate adenylate transferase 2e-08
d2c78a293 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) 7e-04
d1d2ea2103 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) 0.003
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: Elongation factor/aminomethyltransferase common domain
superfamily: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain
family: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain
domain: Elongation factor eEF-1alpha, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 72.9 bits (179), Expect = 2e-17
 Identities = 23/81 (28%), Positives = 38/81 (46%)

Query: 138 MHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYRDVKE 197
           +   +   +     LL +  + SG+ +   P+ L    +A V     +PMCVE + +   
Sbjct: 25  LDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPP 84

Query: 198 LGRFMLRVSGVTIAAGLITKV 218
           LGRF +R    T+A G+I  V
Sbjct: 85  LGRFAVRDMRQTVAVGVIKSV 105
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 107 Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 105 Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1f60a2107 Elongation factor eEF-1alpha, C-terminal domain {B 99.97
d1jnya2107 Elongation factor eEF-1alpha, C-terminal domain {A 99.96
d1zunb2105 Sulfate adenylate transferase subunit cysN/C, EF-T 99.91
d1d2ea2103 Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mi 99.79
d2c78a293 Elongation factor Tu (EF-Tu) {Thermus thermophilus 99.77
d1r5ba268 Eukaryotic peptide chain release factor ERF2, C-te 99.33
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 98.7
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 98.65
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 98.44
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 98.39
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 98.35
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 98.27
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 98.06
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 98.03
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 98.03
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.86
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 97.57
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 96.04
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 95.81
d1kk1a289 Initiation factor eIF2 gamma subunit {Archaeon Pyr 94.4
d1s0ua290 Initiation factor eIF2 gamma subunit {Archaeon Met 92.68
d2qn6a295 Initiation factor eIF2 gamma subunit {Sulfolobus s 88.36
d1s04a_110 Hypothetical protein PF0455 {Pyrococcus furiosus [ 81.39
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: Elongation factor/aminomethyltransferase common domain
superfamily: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain
family: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain
domain: Elongation factor eEF-1alpha, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.97  E-value=5.5e-31  Score=205.63  Aligned_cols=105  Identities=24%  Similarity=0.323  Sum_probs=101.7

Q ss_pred             cceEEEEEEeCCCccCcCCCCeEEEEEecceEEEEEEEeeeecccCccceeccCCcccCCCCeeEEEEEeCceEEeeecc
Q psy15204        114 SRSVKLVKLSNVYQVGFIKELKVGMHQQSLAESAVITRLLSQVHKTSGEVIRKKPRALTKSMSAQVVIETVRPMCVELYR  193 (232)
Q Consensus       114 s~~a~Iv~L~~e~~~PI~~Gy~p~Lh~~T~~v~~rI~kI~~kIDk~Tg~~~kk~pk~Lk~GD~A~V~I~l~kPI~vE~fs  193 (232)
                      +|+|+|++|  +|+.+|.+||+++||+||++++|+|.+|.+++|++||+..+++|++++.||.|+|+|++++|+|+|.|+
T Consensus         3 sF~A~v~vl--~hp~~I~~Gy~~v~h~ht~~~~~~i~kl~~~~d~~tg~~~~~~P~~l~~g~~a~v~i~~~~pi~vE~~~   80 (107)
T d1f60a2           3 SFNATVIVL--NHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFS   80 (107)
T ss_dssp             EEEEEEEEC--SCSCCBCTTCCCEEEETTEEEEEEEEEEEEEECTTTCCEEEESCSCBCTTCEEEEEEEESSCCCCCCTT
T ss_pred             cEEEEEEEE--CCCCcccCCceEEEEecceeeeeEHhhhhhhhcccCCCEeccCCcccCCCCEEEEEEEeCCCCEEeecc
Confidence            588999999  699999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceeeEEEEECCCeEEEEEEEEeee
Q psy15204        194 DVKELGRFMLRVSGVTIAAGLITKVIF  220 (232)
Q Consensus       194 ~~p~LGRFiLRD~g~TVAaGiI~~V~~  220 (232)
                      ++|+||||+|||+|+|||+|+|++|.+
T Consensus        81 ~~p~LGRf~lRd~g~TVAiG~V~~V~k  107 (107)
T d1f60a2          81 EYPPLGRFAVRDMRQTVAVGVIKSVDK  107 (107)
T ss_dssp             TCGGGSEEEEEETTEEEEEEEEEEEEC
T ss_pred             CCCCceeEEEEECCCEEEEEEEEEecC
Confidence            999999999999999999999999864
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s04a_ b.122.1.6 (A:) Hypothetical protein PF0455 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure