Diaphorina citri psyllid: psy15210

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MLKEIEDNTNKLNNKIKEIEFHQFFNDPLDFNNCFIDIQSGAGGIEAQDWASMLLRQYLRYCERKGFIVEILEKSNGEITGIKTVTLKIKGKYAYGFLKSESGIHRLVRKSPFDSSNNRHTSFSSLFVYPEINNLINININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQHRNKSEAWDMLKSKLYKLKLQYQIKEKKKLEDTKKDIKWGYQIRSYVLDKSRIKDLRTNLETKNIKDILDGDLDNFIIASLKQHLLNKITKN
cHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEECcccccccccEEEEEEEEccccEEccccccCEEEEEccccccccccccccEEEEEECcccccEEEEEcccccEEEEEEccccccccccccccEEEEccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccc
**KEI**NTNKLNNKIKEIEFHQFFNDPLDFNNCFIDIQSGAGGIEAQDWASMLLRQYLRYCERKGFIVEILEKSNGEITGIKTVTLKIKGKYAYGFLKSESGIHRLVRKSPFDSSNNRHTSFSSLFVYPEINNLINININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQ*RNKSEAWDMLKSKLYKLKLQYQIKE*K*********KWGYQIRSYVLDKSRIKDLRTNLETKNIKDILDGDLDNFIIASLKQHLLN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxQFFNDPLDFNNCFIDIQSGAGGIEAQDWASMLLRQYLRYCERKGFIVEILEKSNGEITGIKTVTLKIKGKYAYGFLKSESGIHRLVRKSPFDSSNNRHTSFSSLFVYPEINNLINININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQHRNKSEAWDMLKSKLYKLKLQYQIKEKKKLEDTKKDIKWGYQIRSYVLDKSRIKDLRTNLETKNIKDILDGDLDNFIIASLKQHLLNKITKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide chain release factor 2 Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.very confidentA6SXF4
Peptide chain release factor 2 Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.confidentA1W9H4
Peptide chain release factor 2 Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.confidentP66025

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0015862 [BP]uridine transportprobableGO:0015931, GO:0015864, GO:0006810, GO:0015858, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:1901264

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GQE, chain A
Confidence level:very confident
Coverage over the Query: 1-270
View the alignment between query and template
View the model in PyMOL