Diaphorina citri psyllid: psy15214


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MNIYSHSLNTSRIKNLYYNYNTDTKIDIRTILSTNSTNSNLLSIANTGLLFHPTFLATKIQTAGRGRAGRIWYSEPEITLTFSLAWKFKISLKYLTSLPLVISIALSIALKKFGQKVQLKWPNDLLLNGNKFCGILIDTCIEKKNNNWAIIGIGLNLGLPRILSKKINIGNISELLNMEHEKLLAVFICYLIDSLKLFEHYGFSIFMKYWNFNHAYTNKTVDILKLNKIQKGIVIGINKNGCLLLNTKFGKITISSGDVSLRLKK
cccccccccHHHHHHHcccccccccCEEEEEcccccHHHHHHHHHHcccccccCEEEEcccccccccccccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHccccccccccccEEEcccEEEEEEEEcccccccccEEEEEEEEEccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEEEEEccEEEEEEEEEEcccccEEEEEccCEEEEEEEEEEEECcc
***YSHSLNTSRIKNLYYNYNTDTKIDIRTILSTNSTNSNLLSIANTGLLFHPTFLATKIQTAGRGRAGRIWYSEPEITLTFSLAWKFKISLKYLTSLPLVISIALSIALKKFGQKVQLKWPNDLLLNGNKFCGILIDTCIEKKNNNWAIIGIGLNLGLPRILSKKINIGNISELLNMEHEKLLAVFICYLIDSLKLFEHYGFSIFMKYWNFNHAYTNKTVDILKLNKIQKGIVIGINKNGCLLLNTKFGKITISSGDVSLRL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIYSHSLNTSRIKNLYYNYNTDTKIDIRTILSTNSTNSNLLSIANTGLLFHPTFLATKIQTAGRGRAGRIWYSEPEITLTFSLAWKFKISLKYLTSLPLVISIALSIALKKFGQKVQLKWPNDLLLNGNKFCGILIDTCIEKKNNNWAIIGIGLNLGLPRILSKKINIGNISELLNMEHEKLLAVFICYLIDSLKLFEHYGFSIFMKYWNFNHAYTNKTVDILKLNKIQKGIVIGINKNGCLLLNTKFGKITISSGDVSLRLKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative biotin ligase confidentQ59014
Bifunctional protein BirA BirA acts both as a biotin-operon repressor and as the enzyme that synthesizes the corepressor, acetyl-CoA:carbon-dioxide ligase. This protein also activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins.confidentP37416
Biotin--[acetyl-CoA-carboxylase] synthetase Activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins.confidentP29906

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RUX, chain A
Confidence level:very confident
Coverage over the Query: 6-261
View the alignment between query and template
View the model in PyMOL