Diaphorina citri psyllid: psy15220

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQIRST

ccccHHEEEEEccccccccccccccccccccccHHHHHHHHHHHccccccccccCEEEEEEEEccCEEEECccccHHHHHHHHcccccccccccccccCEEEHHHHHHHHHHccccccHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccEEEcccccccCEEEEEEcccccHHHHHHcccccccHHHHHHHHHccccccCEEEEcccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccc

*VKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAA************KVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSG*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L11	This protein binds directly to 23S ribosomal RNA.	confident	Q2YB09
50S ribosomal protein L11	This protein binds directly to 23S ribosomal RNA.	confident	Q3JMP9
50S ribosomal protein L11	This protein binds directly to 23S ribosomal RNA.	confident	B2JIH8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0015968 [BP]	stringent response	probable	GO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0045947 [BP]	negative regulation of translational initiation	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0006446, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0017148, GO:0006417, GO:0010558, GO:0048523
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QOY, chain A
Confidence level:very confident
Coverage over the Query: 140-288
View the alignment between query and template
View the model in PyMOL

Template: 3BBO, chain K
Confidence level:very confident
Coverage over the Query: 1-141
View the alignment between query and template
View the model in PyMOL