Psyllid ID: psy15220

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQIRST
ccccHHEEEEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEEEEccEEEEEEccccHHHHHHHHHccccccccccccccEEEEHHHHHHHHHHccccccHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccEEEcccccccEEEEEEEcccccHHHHHHcccccccHHHHHHHHHccccccEEEEEcccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccc
cccEEEEEEEEEcccccccccccccHHHccccccHHHHHHHccccccccEccccccEEEEEEccccccEEccccHHHHHHHHHccccccccccccccccHEEEEEHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHccccccEcHHHHHHHHHcccccccccEEEEEEEEccccccHHHccEEEEEccccccccccEEEEcccHHHHHHHHccccEEEcHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHHccccccccccEcccHHHHHHHHHccEEccc
MVKKITGFIklqipagkanpsppigpalgqrgLNIMEFCKNFnaqtqgielgtpiPVIITVFSdksftfkkkvtPVTFLIKKAagiqkgsakphsdkvgklTYLQIKEIATIKNVDLTAASISAAMRTIAGSArsmgiifdknkiysfDSAITLIKEAAtakfdesidisIHLNVnikrsdqivrgsivlpfstgkkiYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNevscdlviaspesMHIVSSLgkilgpkglmpnikdgtlnSDILTAIKNaksgqirst
MVKKITGFIklqipagkanpsppiGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKkaagiqkgsakphsdkvgKLTYLQIKEIatiknvdltaASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAAtakfdesidISIHlnvnikrsdqivrgsivlpfstgKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTaiknaksgqirst
MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQIRST
******GFIKLQI*************ALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQ*********KVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTA************
*VKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAA*************VGKLTYLQIKEIATIKNVDLTAASISAAMRT************DKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSG*****
MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAA************KVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNA********
*VKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQKG*AKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQIRST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
B2UF71143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.765 2e-57
Q8XUZ4143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.758 2e-57
Q7W0S3143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.751 2e-56
Q1LI16143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.751 5e-56
B3R7U0143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.751 5e-56
Q0K602143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.751 5e-56
A9IJ32143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.751 6e-56
Q46WD0143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.744 6e-56
C1DAQ6143 50S ribosomal protein L11 yes N/A 0.477 0.965 0.753 8e-56
Q47JB4143 50S ribosomal protein L11 yes N/A 0.487 0.986 0.744 9e-56
>sp|B2UF71|RL11_RALPJ 50S ribosomal protein L11 OS=Ralstonia pickettii (strain 12J) GN=rplK PE=3 SV=1 Back     alignment and function desciption
 Score =  223 bits (567), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%)

Query: 1   MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIIT 60
           M KKI GFIKLQIPAGKANPSPP+GPALGQRGLNIMEFCK FNAQTQG+E G P+PV+IT
Sbjct: 1   MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVIT 60

Query: 61  VFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAA 120
            F+DKSFTF  K  P T LIKKAAGIQKGSAKPH+DKVGK+T  Q +EIA  KN DLTAA
Sbjct: 61  AFADKSFTFVMKSPPATVLIKKAAGIQKGSAKPHTDKVGKITRAQAEEIAKAKNADLTAA 120

Query: 121 SISAAMRTIAGSARSMGIIFD 141
            + AA+RTIAGSARSMGI  +
Sbjct: 121 DLDAAVRTIAGSARSMGITVE 141
This protein binds directly to 23S ribosomal RNA.
Ralstonia pickettii (strain 12J) (taxid: 402626)
>sp|Q8XUZ4|RL11_RALSO 50S ribosomal protein L11 OS=Ralstonia solanacearum (strain GMI1000) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|Q7W0S3|RL11_BORPE 50S ribosomal protein L11 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|Q1LI16|RL11_RALME 50S ribosomal protein L11 OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|B3R7U0|RL11_CUPTR 50S ribosomal protein L11 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|Q0K602|RL11_CUPNH 50S ribosomal protein L11 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|A9IJ32|RL11_BORPD 50S ribosomal protein L11 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|Q46WD0|RL11_CUPPJ 50S ribosomal protein L11 OS=Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|C1DAQ6|RL11_LARHH 50S ribosomal protein L11 OS=Laribacter hongkongensis (strain HLHK9) GN=rplK PE=3 SV=1 Back     alignment and function description
>sp|Q47JB4|RL11_DECAR 50S ribosomal protein L11 OS=Dechloromonas aromatica (strain RCB) GN=rplK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
83749361143 LSU ribosomal protein L11P [Ralstonia so 0.487 0.986 0.758 8e-56
187930385143 50S ribosomal protein L11 [Ralstonia pic 0.487 0.986 0.765 1e-55
17547757143 50S ribosomal protein L11 [Ralstonia sol 0.487 0.986 0.758 1e-55
299065396161 50S ribosomal subunit protein L11, N-ter 0.487 0.875 0.758 2e-55
399016976143 50S ribosomal protein L11 [Herbaspirillu 0.487 0.986 0.773 2e-55
421895927143 50s ribosomal subunit protein l11 (methy 0.487 0.986 0.751 2e-55
300702761143 50S ribosomal protein L11 [Ralstonia sol 0.487 0.986 0.751 3e-55
300309443143 50S ribosomal protein L11 [Herbaspirillu 0.487 0.986 0.765 5e-55
415940045143 50S ribosomal protein L11 [Herbaspirillu 0.487 0.986 0.765 6e-55
372487064143 50S ribosomal protein L11 [Dechlorosoma 0.487 0.986 0.758 8e-55
>gi|83749361|ref|ZP_00946357.1| LSU ribosomal protein L11P [Ralstonia solanacearum UW551] gi|207744564|ref|YP_002260956.1| 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum IPO1609] gi|83723986|gb|EAP71168.1| LSU ribosomal protein L11P [Ralstonia solanacearum UW551] gi|206595970|emb|CAQ62897.1| 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum IPO1609] Back     alignment and taxonomy information
 Score =  223 bits (568), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 119/141 (84%)

Query: 1   MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIIT 60
           M KKI GFIKLQIPAGKANPSPP+GPALGQRGLNIMEFCK FNAQTQG+E G P+PV+IT
Sbjct: 1   MAKKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVIT 60

Query: 61  VFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAA 120
            F+DKSFTF  K  P T LIKKAAG+QKGSAKPH+DKVGK+T  Q +EIA  KN DLTAA
Sbjct: 61  AFADKSFTFVMKSPPATVLIKKAAGVQKGSAKPHTDKVGKITRAQAEEIAKAKNADLTAA 120

Query: 121 SISAAMRTIAGSARSMGIIFD 141
            + AA+RTIAGSARSMGI  +
Sbjct: 121 DLDAAVRTIAGSARSMGITVE 141

Source: Ralstonia solanacearum UW551

Species: Ralstonia solanacearum

Genus: Ralstonia

Family: Burkholderiaceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|187930385|ref|YP_001900872.1| 50S ribosomal protein L11 [Ralstonia pickettii 12J] gi|241664553|ref|YP_002982913.1| 50S ribosomal protein L11 [Ralstonia pickettii 12D] gi|309782813|ref|ZP_07677533.1| ribosomal protein L11 [Ralstonia sp. 5_7_47FAA] gi|404397509|ref|ZP_10989299.1| 50S ribosomal protein L11 [Ralstonia sp. 5_2_56FAA] gi|226702763|sp|B2UF71.1|RL11_RALPJ RecName: Full=50S ribosomal protein L11 gi|187727275|gb|ACD28440.1| ribosomal protein L11 [Ralstonia pickettii 12J] gi|240866580|gb|ACS64241.1| ribosomal protein L11 [Ralstonia pickettii 12D] gi|308918237|gb|EFP63914.1| ribosomal protein L11 [Ralstonia sp. 5_7_47FAA] gi|348612720|gb|EGY62334.1| 50S ribosomal protein L11 [Ralstonia sp. 5_2_56FAA] Back     alignment and taxonomy information
>gi|17547757|ref|NP_521159.1| 50S ribosomal protein L11 [Ralstonia solanacearum GMI1000] gi|38605395|sp|Q8XUZ4.1|RL11_RALSO RecName: Full=50S ribosomal protein L11 gi|17430062|emb|CAD16747.1| probable 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum GMI1000] Back     alignment and taxonomy information
>gi|299065396|emb|CBJ36565.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Ralstonia solanacearum CMR15] Back     alignment and taxonomy information
>gi|399016976|ref|ZP_10719178.1| 50S ribosomal protein L11 [Herbaspirillum sp. CF444] gi|409408689|ref|ZP_11257124.1| 50s ribosomal protein L11 [Herbaspirillum sp. GW103] gi|386432011|gb|EIJ44839.1| 50s ribosomal protein L11 [Herbaspirillum sp. GW103] gi|398104399|gb|EJL94538.1| 50S ribosomal protein L11 [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|421895927|ref|ZP_16326326.1| 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum MolK2] gi|206587092|emb|CAQ17676.1| 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum MolK2] Back     alignment and taxonomy information
>gi|300702761|ref|YP_003744362.1| 50S ribosomal protein L11 [Ralstonia solanacearum CFBP2957] gi|421890424|ref|ZP_16321286.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Ralstonia solanacearum K60-1] gi|299070423|emb|CBJ41718.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Ralstonia solanacearum CFBP2957] gi|378964219|emb|CCF98034.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Ralstonia solanacearum K60-1] Back     alignment and taxonomy information
>gi|300309443|ref|YP_003773535.1| 50S ribosomal protein L11 [Herbaspirillum seropedicae SmR1] gi|300072228|gb|ADJ61627.1| 50s ribosomal subunit L11 protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|415940045|ref|ZP_11555611.1| 50S ribosomal protein L11 [Herbaspirillum frisingense GSF30] gi|407759217|gb|EKF68941.1| 50S ribosomal protein L11 [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|372487064|ref|YP_005026629.1| 50S ribosomal protein L11 [Dechlorosoma suillum PS] gi|359353617|gb|AEV24788.1| 50S ribosomal protein L11 [Dechlorosoma suillum PS] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TIGR_CMR|CPS_4773142 CPS_4773 "ribosomal protein L1 0.487 0.992 0.617 4.4e-45
TIGR_CMR|GSU_2867141 GSU_2867 "ribosomal protein L1 0.474 0.971 0.681 5.6e-45
UNIPROTKB|Q9KV34142 rplK "50S ribosomal protein L1 0.487 0.992 0.602 1e-43
TIGR_CMR|VC_0324142 VC_0324 "ribosomal protein L11 0.487 0.992 0.602 1e-43
UNIPROTKB|P0A7J7142 rplK "50S ribosomal subunit pr 0.487 0.992 0.588 1.2e-42
TIGR_CMR|SO_0220142 SO_0220 "ribosomal protein L11 0.487 0.992 0.553 5.9e-41
TIGR_CMR|CBU_0226145 CBU_0226 "ribosomal protein L1 0.477 0.951 0.604 6.8e-40
TIGR_CMR|CPS_4772232 CPS_4772 "ribosomal protein L1 0.560 0.698 0.506 2.9e-39
TIGR_CMR|SPO_3514141 SPO_3514 "ribosomal protein L1 0.477 0.978 0.579 6.1e-39
TIGR_CMR|CBU_0227232 CBU_0227 "ribosomal protein L1 0.505 0.629 0.5 4.3e-38
TIGR_CMR|CPS_4773 CPS_4773 "ribosomal protein L11" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 4.4e-45, P = 4.4e-45
 Identities = 87/141 (61%), Positives = 112/141 (79%)

Query:     1 MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIIT 60
             M KK+   IKLQ+ AG ANPSPP+GPALGQ G+NIMEFCK FNA+T  +E G P+PV+IT
Sbjct:     1 MAKKVQALIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAKTDSLEKGAPVPVVIT 60

Query:    61 VFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAA 120
             V+SD+SFTF+ K  P +FL+KKAAGI+ GS +P++DKVG +T  Q++EI   K  DLTA 
Sbjct:    61 VYSDRSFTFETKTPPASFLLKKAAGIKSGSGRPNTDKVGTVTTAQLEEIVKTKEPDLTAG 120

Query:   121 SISAAMRTIAGSARSMGIIFD 141
             S+ AA+RTIAGSARSMG++ +
Sbjct:   121 SLEAAVRTIAGSARSMGLVVE 141
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
GO:0015934 "large ribosomal subunit" evidence=ISS
TIGR_CMR|GSU_2867 GSU_2867 "ribosomal protein L11" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KV34 rplK "50S ribosomal protein L11" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0324 VC_0324 "ribosomal protein L11" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A7J7 rplK "50S ribosomal subunit protein L11" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0220 SO_0220 "ribosomal protein L11" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0226 CBU_0226 "ribosomal protein L11" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4772 CPS_4772 "ribosomal protein L1" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3514 SPO_3514 "ribosomal protein L11" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0227 CBU_0227 "ribosomal protein L1" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2YB09RL11_NITMUNo assigned EC number0.73910.47750.9650yesN/A
Q3JMP9RL11_BURP1No assigned EC number0.72340.48780.9860yesN/A
B2JIH8RL11_BURP8No assigned EC number0.73750.48780.9860yesN/A
Q5F5R1RL11_NEIG1No assigned EC number0.71730.47750.9583yesN/A
Q13TF8RL11_BURXLNo assigned EC number0.73040.48780.9860yesN/A
Q7WRE3RL11_BORBRNo assigned EC number0.74460.48780.9860yesN/A
Q8XUZ4RL11_RALSONo assigned EC number0.75880.48780.9860yesN/A
Q9K1J3RL11_NEIMBNo assigned EC number0.71730.47750.9583yesN/A
Q7W2H3RL11_BORPANo assigned EC number0.74460.48780.9860yesN/A
B2T763RL11_BURPPNo assigned EC number0.72340.48780.9860yesN/A
Q1BRT6RL11_BURCANo assigned EC number0.72340.48780.9860yesN/A
Q63PZ9RL11_BURPSNo assigned EC number0.72340.48780.9860yesN/A
A6T3L7RL11_JANMANo assigned EC number0.73750.48780.9860yesN/A
Q47JB4RL11_DECARNo assigned EC number0.74460.48780.9860yesN/A
Q7W0S3RL11_BORPENo assigned EC number0.75170.48780.9860yesN/A
Q9JX02RL11_NEIMANo assigned EC number0.71730.47750.9583yesN/A
A4G9U9RL11_HERARNo assigned EC number0.74460.48780.9860yesN/A
Q2SU15RL11_BURTANo assigned EC number0.72340.48780.9860yesN/A
A1KRG2RL11_NEIMFNo assigned EC number0.71730.47750.9583yesN/A
Q1LI16RL11_RALMENo assigned EC number0.75170.48780.9860yesN/A
B1YRB8RL11_BURA4No assigned EC number0.72340.48780.9860yesN/A
A4SUV0RL11_POLSQNo assigned EC number0.72340.48780.9860yesN/A
A3NEJ1RL11_BURP6No assigned EC number0.72340.48780.9860yesN/A
A9ADI1RL11_BURM1No assigned EC number0.71630.48780.9860yesN/A
A4JAM8RL11_BURVGNo assigned EC number0.72340.48780.9860yesN/A
Q2L2N9RL11_BORA1No assigned EC number0.74460.48780.9860yesN/A
Q39KH9RL11_BURS3No assigned EC number0.72340.48780.9860yesN/A
Q3SF21RL11_THIDANo assigned EC number0.70210.48780.9860yesN/A
Q46WD0RL11_CUPPJNo assigned EC number0.74460.48780.9860yesN/A
A5EX74RL11_DICNVNo assigned EC number0.67600.49131.0yesN/A
A1V8B6RL11_BURMSNo assigned EC number0.72340.48780.9860yesN/A
A2S7G2RL11_BURM9No assigned EC number0.72340.48780.9860yesN/A
Q0K602RL11_CUPNHNo assigned EC number0.75170.48780.9860yesN/A
B2UF71RL11_RALPJNo assigned EC number0.76590.48780.9860yesN/A
B3R7U0RL11_CUPTRNo assigned EC number0.75170.48780.9860yesN/A
A1KB38RL11_AZOSBNo assigned EC number0.73040.48780.9860yesN/A
A3P0C9RL11_BURP0No assigned EC number0.72340.48780.9860yesN/A
B1JU10RL11_BURCCNo assigned EC number0.72340.48780.9860yesN/A
A9IJ32RL11_BORPDNo assigned EC number0.75170.48780.9860yesN/A
Q0BJ58RL11_BURCMNo assigned EC number0.72340.48780.9860yesN/A
B1XSE8RL11_POLNSNo assigned EC number0.71630.48780.9860yesN/A
B4E5A8RL11_BURCJNo assigned EC number0.72340.48780.9860yesN/A
P60100RL11_CHRVONo assigned EC number0.73910.47750.9650yesN/A
C1DAQ6RL11_LARHHNo assigned EC number0.75360.47750.9650yesN/A
Q82T71RL11_NITEUNo assigned EC number0.70920.48780.9860yesN/A
Q5P343RL11_AROAENo assigned EC number0.73040.48780.9860yesN/A
A3MRU1RL11_BURM7No assigned EC number0.72340.48780.9860yesN/A
Q62GJ3RL11_BURMANo assigned EC number0.72340.48780.9860yesN/A
A0K3L3RL11_BURCHNo assigned EC number0.72340.48780.9860yesN/A
B4RQV8RL11_NEIG2No assigned EC number0.71730.47750.9583yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
PRK00140141 PRK00140, rplK, 50S ribosomal protein L11; Validat 2e-79
TIGR01632140 TIGR01632, L11_bact, 50S ribosomal protein L11 4e-66
COG0080141 COG0080, RplK, Ribosomal protein L11 [Translation, 7e-65
PRK05424230 PRK05424, rplA, 50S ribosomal protein L1; Validate 1e-64
smart00649132 smart00649, RL11, Ribosomal protein L11/L12 5e-60
TIGR01169227 TIGR01169, rplA_bact, ribosomal protein L1, bacter 1e-59
cd00349131 cd00349, Ribosomal_L11, Ribosomal protein L11 7e-58
COG0081228 COG0081, RplA, Ribosomal protein L1 [Translation, 3e-50
CHL00127140 CHL00127, rpl11, ribosomal protein L11; Validated 3e-45
CHL00129229 CHL00129, rpl1, ribosomal protein L1; Reviewed 5e-43
cd00403208 cd00403, Ribosomal_L1, Ribosomal protein L1 5e-35
PRK01143163 PRK01143, rpl11p, 50S ribosomal protein L11P; Vali 2e-33
pfam00687200 pfam00687, Ribosomal_L1, Ribosomal protein L1p/L10 3e-33
PRK14539196 PRK14539, PRK14539, 50S ribosomal protein L11/unkn 5e-29
pfam0394659 pfam03946, Ribosomal_L11_N, Ribosomal protein L11, 1e-27
pfam0029869 pfam00298, Ribosomal_L11, Ribosomal protein L11, R 1e-24
TIGR01170141 TIGR01170, rplA_mito, ribosomal protein L1, mitoch 1e-18
PRK04203215 PRK04203, rpl1P, 50S ribosomal protein L1P; Review 3e-13
PTZ00321342 PTZ00321, PTZ00321, ribosomal protein L11; Provisi 2e-10
>gnl|CDD|234661 PRK00140, rplK, 50S ribosomal protein L11; Validated Back     alignment and domain information 
 Score =  236 bits (605), Expect = 2e-79
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (0%)

Query: 1   MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIIT 60
           M KK+ G+IKLQIPAGKANP+PP+GPALGQRG+NIMEFCK FNA+TQ  + G PIPV+IT
Sbjct: 1   MAKKVVGYIKLQIPAGKANPAPPVGPALGQRGVNIMEFCKAFNARTQDQK-GLPIPVVIT 59

Query: 61  VFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAA 120
           V+ D+SFTF  K  P + L+KKAAGI+KGS +P+ +KVGK+T  Q++EIA  K  DL AA
Sbjct: 60  VYEDRSFTFITKTPPASVLLKKAAGIEKGSGEPNKEKVGKITRAQVREIAETKMPDLNAA 119

Query: 121 SISAAMRTIAGSARSMGII 139
            I AAMR IAG+ARSMGI+
Sbjct: 120 DIEAAMRMIAGTARSMGIV 138

Length = 141
>gnl|CDD|233500 TIGR01632, L11_bact, 50S ribosomal protein L11 Back     alignment and domain information
>gnl|CDD|223158 COG0080, RplK, Ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180071 PRK05424, rplA, 50S ribosomal protein L1; Validated Back     alignment and domain information
>gnl|CDD|197819 smart00649, RL11, Ribosomal protein L11/L12 Back     alignment and domain information
>gnl|CDD|211630 TIGR01169, rplA_bact, ribosomal protein L1, bacterial/chloroplast Back     alignment and domain information
>gnl|CDD|100101 cd00349, Ribosomal_L11, Ribosomal protein L11 Back     alignment and domain information
>gnl|CDD|223159 COG0081, RplA, Ribosomal protein L1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177049 CHL00127, rpl11, ribosomal protein L11; Validated Back     alignment and domain information
>gnl|CDD|177051 CHL00129, rpl1, ribosomal protein L1; Reviewed Back     alignment and domain information
>gnl|CDD|238235 cd00403, Ribosomal_L1, Ribosomal protein L1 Back     alignment and domain information
>gnl|CDD|234908 PRK01143, rpl11p, 50S ribosomal protein L11P; Validated Back     alignment and domain information
>gnl|CDD|216061 pfam00687, Ribosomal_L1, Ribosomal protein L1p/L10e family Back     alignment and domain information
>gnl|CDD|184732 PRK14539, PRK14539, 50S ribosomal protein L11/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|217808 pfam03946, Ribosomal_L11_N, Ribosomal protein L11, N-terminal domain Back     alignment and domain information
>gnl|CDD|189492 pfam00298, Ribosomal_L11, Ribosomal protein L11, RNA binding domain Back     alignment and domain information
>gnl|CDD|233298 TIGR01170, rplA_mito, ribosomal protein L1, mitochondrial Back     alignment and domain information
>gnl|CDD|235254 PRK04203, rpl1P, 50S ribosomal protein L1P; Reviewed Back     alignment and domain information
>gnl|CDD|240358 PTZ00321, PTZ00321, ribosomal protein L11; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
COG0080141 RplK Ribosomal protein L11 [Translation, ribosomal 100.0
TIGR01632140 L11_bact 50S ribosomal protein L11. This model rep 100.0
CHL00127140 rpl11 ribosomal protein L11; Validated 100.0
PRK00140141 rplK 50S ribosomal protein L11; Validated 100.0
PRK01143163 rpl11p 50S ribosomal protein L11P; Validated 100.0
PLN03072166 60S ribosomal protein L12; Provisional 100.0
smart00649132 RL11 Ribosomal protein L11/L12. 100.0
cd00349131 Ribosomal_L11 Ribosomal protein L11. Ribosomal pro 100.0
PRK14539196 50S ribosomal protein L11/unknown domain fusion pr 100.0
PTZ00321342 ribosomal protein L11; Provisional 100.0
KOG3257|consensus168 100.0
PTZ00105140 60S ribosomal protein L12; Provisional 100.0
COG0081228 RplA Ribosomal protein L1 [Translation, ribosomal 100.0
CHL00129229 rpl1 ribosomal protein L1; Reviewed 100.0
TIGR01169227 rplA_bact ribosomal protein L1, bacterial/chloropl 100.0
PRK05424230 rplA 50S ribosomal protein L1; Validated 100.0
TIGR01170141 rplA_mito ribosomal protein L1, mitochondrial. Thi 100.0
PRK04203215 rpl1P 50S ribosomal protein L1P; Reviewed 100.0
PTZ00225214 60S ribosomal protein L10a; Provisional 100.0
PTZ00029216 60S ribosomal protein L10a; Provisional 99.97
KOG0886|consensus167 99.97
KOG1569|consensus323 99.96
cd00403208 Ribosomal_L1 Ribosomal protein L1. The L1 protein, 99.95
PF0029869 Ribosomal_L11: Ribosomal protein L11, RNA binding 99.94
PF0394660 Ribosomal_L11_N: Ribosomal protein L11, N-terminal 99.94
PF00687220 Ribosomal_L1: Ribosomal protein L1p/L10e family; I 99.82
KOG1570|consensus218 99.58
PF13003133 MRL1: Ribosomal protein L1; InterPro: IPR024663 Th 96.58
PTZ00029216 60S ribosomal protein L10a; Provisional 91.24
PTZ00225214 60S ribosomal protein L10a; Provisional 84.75
>COG0080 RplK Ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-59  Score=386.71  Aligned_cols=141  Identities=59%  Similarity=0.955  Sum_probs=137.6

Q ss_pred             ccceeEEEEEEeecccCCCCCCCCcccCCCCCChHHHHHHHHHHhcCCcCCCceeEEEEEecCCeEEEEEeCCChHHHHH
Q psy15220          2 VKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIK   81 (289)
Q Consensus         2 ~k~~~~~i~l~v~~G~a~p~pplgp~LG~~Gin~~~f~k~fN~~T~~~~~g~~vpv~i~v~~drsf~~~v~~Pp~s~ll~   81 (289)
                      +|++.++|+|+|+||+|+|+|||||+|||+|||+|+|||+||++|++|+ |++|||+||||+||||+|++++||+|+||+
T Consensus         1 a~k~~~~ikl~v~aGkA~p~PpvGPALG~~Gvni~~f~k~fN~~T~~~~-G~~vPV~Itv~~drsftf~~ktPPas~Llk   79 (141)
T COG0080           1 AKKVVKIIKLQVPAGKANPSPPVGPALGQLGVNIMEFCKEFNAATKDEK-GLPVPVVITVYEDRSFTFIVKTPPASALLK   79 (141)
T ss_pred             CCccceEEEEEecccccCCCCCCCccccccCCCHHHHHHHHHHHhhccC-CCeeeEEEEEEcCCcEEEEECCCCHHHHHH
Confidence            4668999999999999999999999999999999999999999999966 999999999999999999999999999999


Q ss_pred             HHhCCCCCCCCCCCceeecccHHHHHHHHHhhhhccchhhHHHHHHHhhhcccccceecccc
Q psy15220         82 KAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDKN  143 (289)
Q Consensus        82 ka~g~~~g~~~~~~~~~g~it~~~v~eIA~~k~~d~~~~~l~~~vk~v~Gta~smGi~V~~k  143 (289)
                      |++|+++||++|+++++|+||++||+|||++|++||++.+|++|+|+|+||||||||+|+++
T Consensus        80 Ka~g~~~Gs~~p~k~~vG~lt~~qv~eIA~~K~~dl~a~~l~aA~k~I~GTa~SMGv~Veg~  141 (141)
T COG0080          80 KAAGIEKGSGKPNKNKVGKLTLAQVREIAKTKMPDLNAKDLEAAVKEILGTARSMGVTVEGK  141 (141)
T ss_pred             HHhCCCCCCCCCCcceeeeeeHHHHHHHHHHhhhhhhhHHHHHHHHHHhhhhhhceEEeecC
Confidence            99999999999999999999999999999999999999999999999999999999999974

>TIGR01632 L11_bact 50S ribosomal protein L11 Back     alignment and domain information
>CHL00127 rpl11 ribosomal protein L11; Validated Back     alignment and domain information
>PRK00140 rplK 50S ribosomal protein L11; Validated Back     alignment and domain information
>PRK01143 rpl11p 50S ribosomal protein L11P; Validated Back     alignment and domain information
>PLN03072 60S ribosomal protein L12; Provisional Back     alignment and domain information
>smart00649 RL11 Ribosomal protein L11/L12 Back     alignment and domain information
>cd00349 Ribosomal_L11 Ribosomal protein L11 Back     alignment and domain information
>PRK14539 50S ribosomal protein L11/unknown domain fusion protein; Provisional Back     alignment and domain information
>PTZ00321 ribosomal protein L11; Provisional Back     alignment and domain information
>KOG3257|consensus Back     alignment and domain information
>PTZ00105 60S ribosomal protein L12; Provisional Back     alignment and domain information
>COG0081 RplA Ribosomal protein L1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00129 rpl1 ribosomal protein L1; Reviewed Back     alignment and domain information
>TIGR01169 rplA_bact ribosomal protein L1, bacterial/chloroplast Back     alignment and domain information
>PRK05424 rplA 50S ribosomal protein L1; Validated Back     alignment and domain information
>TIGR01170 rplA_mito ribosomal protein L1, mitochondrial Back     alignment and domain information
>PRK04203 rpl1P 50S ribosomal protein L1P; Reviewed Back     alignment and domain information
>PTZ00225 60S ribosomal protein L10a; Provisional Back     alignment and domain information
>PTZ00029 60S ribosomal protein L10a; Provisional Back     alignment and domain information
>KOG0886|consensus Back     alignment and domain information
>KOG1569|consensus Back     alignment and domain information
>cd00403 Ribosomal_L1 Ribosomal protein L1 Back     alignment and domain information
>PF00298 Ribosomal_L11: Ribosomal protein L11, RNA binding domain; InterPro: IPR020783 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF03946 Ribosomal_L11_N: Ribosomal protein L11, N-terminal domain; InterPro: IPR020784 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF00687 Ribosomal_L1: Ribosomal protein L1p/L10e family; InterPro: IPR002143 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1570|consensus Back     alignment and domain information
>PF13003 MRL1: Ribosomal protein L1; InterPro: IPR024663 This entry represents a ribosomal protein L1 domain found mainly in chordates Back     alignment and domain information
>PTZ00029 60S ribosomal protein L10a; Provisional Back     alignment and domain information
>PTZ00225 60S ribosomal protein L10a; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
1vs6_I142 Crystal Structure Of The Bacterial Ribosome From Es 1e-46
1p85_G141 Real Space Refined Coordinates Of The 50s Subunit F 6e-46
2gya_G139 Structure Of The 50s Subunit Of A Pre-Translocation 7e-46
1mj1_L141 Crystal Structure Of The Ribosome At 5.5 A Resoluti 3e-41
1eg0_K140 Fitting Of Components With Known Structure Into An 3e-41
1mms_A140 Crystal Structure Of The Ribosomal Protein L11-Rna 1e-40
1jqm_A139 Fitting Of L11 Protein And Elongation Factor G (Ef- 1e-40
1nkw_G144 Crystal Structure Of The Large Ribosomal Subunit Fr 1e-39
487d_L133 Seven Ribosomal Proteins Fitted To A Cryo-Electron 1e-39
1pnu_G143 Crystal Structure Of A Streptomycin Dependent Ribos 1e-39
1r2w_A141 Coordinates Of L11 With 58nts Of 23s Rrna Fitted In 3e-39
2j03_K147 Structure Of The Thermus Thermophilus 70s Ribosome 3e-38
3fin_L138 T. Thermophilus 70s Ribosome In Complex With Mrna, 5e-38
3cjr_B147 Ribosomal Protein L11 Methyltransferase (prma) In C 1e-37
3cjq_B146 Ribosomal Protein L11 Methyltransferase (Prma) In C 2e-37
3fik_5234 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 1e-36
2rdo_9233 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 2e-36
2gya_2222 Structure Of The 50s Subunit Of A Pre-Translocation 2e-36
3bbo_K224 Homology Model For The Spinach Chloroplast 50s Subu 9e-35
1ad2_A228 Ribosomal Protein L1 Mutant With Serine 179 Replace 1e-31
2hgj_C229 Fitting Of Components With Known Structure Into An 1e-31
1ml5_c228 Crystal Structure Of The Ribosome At 5.5 A Resoluti 1e-31
4f9t_A229 Ribosomal Protein L1 From Thermus Thermophilus With 1e-31
3umy_A228 Crystal Structure Of Mutant Ribosomal Protein T217a 1e-31
3u42_A229 Mutant Ribosomal Protein L1 From Thermus Thermophil 1e-31
487d_H224 Seven Ribosomal Proteins Fitted To A Cryo-Electron 1e-31
2j01_C229 Structure Of The Thermus Thermophilus 70s Ribosome 2e-31
3zvp_C229 Crystal Structure Of The Hybrid State Of Ribosome I 2e-31
3egv_B146 Ribosomal Protein L11 Methyltransferase (Prma) In C 5e-31
3qoy_A242 Crystal Structure Of Ribosomal Protein L1 From Aqui 1e-30
1zho_A228 The Structure Of A Ribosomal Protein L1 In Complex 1e-30
2v49_C229 Structure Of The Ribosome Recycling Factor Bound To 2e-30
3tg8_A228 Mutant Ribosomal Protein L1 Lacking Ala158 From The 4e-30
2hw8_A228 Structure Of Ribosomal Protein L1-Mrna Complex At 2 4e-30
3bbo_D352 Homology Model For The Spinach Chloroplast 50s Subu 2e-25
2ftc_G145 Structural Model For The Large Subunit Of The Mamma 7e-24
1s72_I162 Refined Crystal Structure Of The Haloarcula Marismo 1e-20
2otj_I161 13-Deoxytedanolide Bound To The Large Subunit Of Ha 2e-20
3fin_C191 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-20
2bcw_A65 Coordinates Of The N-Terminal Domain Of Ribosomal P 3e-19
3cjs_B72 Minimal Recognition Complex Between Prma And Riboso 2e-17
3j21_H164 Promiscuous Behavior Of Proteins In Archaeal Riboso 3e-17
1hc8_A76 Crystal Structure Of A Conserved Ribosomal Protein- 3e-15
1y39_A76 Co-Evolution Of Protein And Rna Structures Within A 7e-15
1aci_A76 L11 Ribosomal Protein Rna Binding Domain, Nmr, 20 S 1e-14
1qa6_A67 Crystal Structure Of A Conserved Ribosomal Protein- 4e-13
2ov7_A137 The First Domain Of The Ribosomal Protein L1 From T 1e-10
3g4s_I70 Co-Crystal Structure Of Tiamulin Bound To The Large 6e-06
3j21_A216 Promiscuous Behavior Of Proteins In Archaeal Riboso 1e-05
1dwu_A213 Ribosomal Protein L1 Length = 213 3e-05
2zkr_5212 Structure Of A Mammalian Ribosomal 60s Subunit With 9e-05
>pdb|1VS6|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 142 Back     alignment and structure 
Iteration: 1

 Score =  182 bits (463), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 108/141 (76%)
Query: 1   MVKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIIT 60
           M KK+  ++KLQ+ AG ANPSPP+GPALGQ+G+NIMEFCK FNA+T  IE G PIPV+IT
Sbjct: 1   MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVIT 60
Query: 61  VFSDKSFTFKKKVTPVTFLIKKAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAA 120
           V++D+SFTF  K  P   L+KKAAGI+ GS KP+ DKVGK++  Q++EIA  K  D+T A
Sbjct: 61  VYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGA 120
Query: 121 SISAAMRTIAGSARSMGIIFD 141
            I A  R+I G+ARSMG++ +
Sbjct: 121 DIEAMTRSIEGTARSMGLVVE 141
>pdb|1P85|G Chain G, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 141 Back     alignment and structure
>pdb|2GYA|G Chain G, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 139 Back     alignment and structure
>pdb|1MJ1|L Chain L, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 141 Back     alignment and structure
>pdb|1MMS|A Chain A, Crystal Structure Of The Ribosomal Protein L11-Rna Complex Length = 140 Back     alignment and structure
>pdb|1JQM|A Chain A, Fitting Of L11 Protein And Elongation Factor G (Ef-G) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G, Gdp And Fusidic Acid Length = 139 Back     alignment and structure
>pdb|1NKW|G Chain G, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 144 Back     alignment and structure
>pdb|487D|L Chain L, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 133 Back     alignment and structure
>pdb|1PNU|G Chain G, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 143 Back     alignment and structure
>pdb|1R2W|A Chain A, Coordinates Of L11 With 58nts Of 23s Rrna Fitted Into The Cryo-Em Map Of The 70s Ribosome Length = 141 Back     alignment and structure
>pdb|3FIN|L Chain L, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 138 Back     alignment and structure
>pdb|3CJR|B Chain B, Ribosomal Protein L11 Methyltransferase (prma) In Complex With Ribosomal Protein L11 (k39a) And Inhibitor Sinefungin Length = 147 Back     alignment and structure
>pdb|3CJQ|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 In Space Group P212121 Length = 146 Back     alignment and structure
>pdb|3FIK|5 Chain 5, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 50s Subunit. Length = 234 Back     alignment and structure
>pdb|2RDO|9 Chain 9, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 233 Back     alignment and structure
>pdb|2GYA|2 Chain 2, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 222 Back     alignment and structure
>pdb|3BBO|K Chain K, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 224 Back     alignment and structure
>pdb|1AD2|A Chain A, Ribosomal Protein L1 Mutant With Serine 179 Replaced By Cysteine Length = 228 Back     alignment and structure
>pdb|2HGJ|C Chain C, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. Length = 229 Back     alignment and structure
>pdb|1ML5|CC Chain c, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 Length = 228 Back     alignment and structure
>pdb|4F9T|A Chain A, Ribosomal Protein L1 From Thermus Thermophilus With Substitution Thr217ala Length = 229 Back     alignment and structure
>pdb|3UMY|A Chain A, Crystal Structure Of Mutant Ribosomal Protein T217a Tthl1 In Complex With 80nt 23s Rna From Thermus Thermophilus Length = 228 Back     alignment and structure
>pdb|3U42|A Chain A, Mutant Ribosomal Protein L1 From Thermus Thermophilus With Threonine 217 Replaced By Valine Length = 229 Back     alignment and structure
>pdb|487D|H Chain H, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|2J01|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 229 Back     alignment and structure
>pdb|3ZVP|C Chain C, Crystal Structure Of The Hybrid State Of Ribosome In Complex With The Guanosine Triphosphatase Release Factor 3 Length = 229 Back     alignment and structure
>pdb|3EGV|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Trimethylated Ribosomal Protein L11 Length = 146 Back     alignment and structure
>pdb|3QOY|A Chain A, Crystal Structure Of Ribosomal Protein L1 From Aquifex Aeolicus Length = 242 Back     alignment and structure
>pdb|1ZHO|A Chain A, The Structure Of A Ribosomal Protein L1 In Complex With Mrna Length = 228 Back     alignment and structure
>pdb|2V49|C Chain C, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 4 Of 4). This File Contains The 50s Subunit Of Molecule 2 Length = 229 Back     alignment and structure
>pdb|3TG8|A Chain A, Mutant Ribosomal Protein L1 Lacking Ala158 From Thermus Thermophilus Length = 228 Back     alignment and structure
>pdb|2HW8|A Chain A, Structure Of Ribosomal Protein L1-Mrna Complex At 2.1 Resolution Length = 228 Back     alignment and structure
>pdb|3BBO|D Chain D, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 352 Back     alignment and structure
>pdb|2FTC|G Chain G, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 145 Back     alignment and structure
>pdb|1S72|I Chain I, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 162 Back     alignment and structure
>pdb|2OTJ|I Chain I, 13-Deoxytedanolide Bound To The Large Subunit Of Haloarcula Marismortui Length = 161 Back     alignment and structure
>pdb|3FIN|C Chain C, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 191 Back     alignment and structure
>pdb|2BCW|A Chain A, Coordinates Of The N-Terminal Domain Of Ribosomal Protein L11,C-Terminal Domain Of Ribosomal Protein L7L12 AND A Portion Of The G' Domain Of Elongation Factor G, As Fitted Into Cryo-Em Map Of An Escherichia Coli 70sEf- GGdpFusidic Acid Complex Length = 65 Back     alignment and structure
>pdb|3CJS|B Chain B, Minimal Recognition Complex Between Prma And Ribosomal Protein L11 Length = 72 Back     alignment and structure
>pdb|3J21|H Chain H, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 164 Back     alignment and structure
>pdb|1HC8|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex Length = 76 Back     alignment and structure
>pdb|1Y39|A Chain A, Co-Evolution Of Protein And Rna Structures Within A Highly Conserved Ribosomal Domain Length = 76 Back     alignment and structure
>pdb|1ACI|A Chain A, L11 Ribosomal Protein Rna Binding Domain, Nmr, 20 Structures Length = 76 Back     alignment and structure
>pdb|1QA6|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex Length = 67 Back     alignment and structure
>pdb|2OV7|A Chain A, The First Domain Of The Ribosomal Protein L1 From Thermus Thermophilus Length = 137 Back     alignment and structure
>pdb|3G4S|I Chain I, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 70 Back     alignment and structure
>pdb|3J21|A Chain A, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 216 Back     alignment and structure
>pdb|1DWU|A Chain A, Ribosomal Protein L1 Length = 213 Back     alignment and structure
>pdb|2ZKR|5 Chain 5, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 212 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2wwq_5234 50S ribosomal protein L1; ribosomal protein, ribon 1e-62
3bbo_D352 Ribosomal protein L1; large ribosomal subunit, spi 2e-60
4f9t_A229 50S ribosomal protein L1; rossman fold, RNA; HET: 7e-60
3qoy_A242 50S ribosomal protein L1; beta-alpha-beta, structu 2e-57
1vq8_I162 50S ribosomal protein L11P; ribosome 50S, protein- 5e-51
1mzp_A217 50S ribosomal protein L1P; ribosome, RNA-protein c 6e-45
3bbo_K224 Ribosomal protein L11; large ribosomal subunit, sp 2e-42
3r8s_I141 50S ribosomal protein L11; protein biosynthesis, R 7e-42
3egv_B146 50S ribosomal protein L11, ribosomal protein L11 m 1e-41
1i2a_A219 50S ribosomal protein L1P; primary rRNA-binding pr 2e-41
2zkr_5212 60S ribosomal protein L10A; protein-RNA complex, 6 1e-40
1mms_A140 Protein (ribosomal protein L11); RNA-protein compl 3e-39
2ftc_A189 Mitochondrial ribosomal protein L1; mitochondrial 2e-38
3o58_A217 L10A, 60S ribosomal protein L1; ribosomal RNA and 1e-37
2ftc_G145 L11MT, MRP-L11, 39S ribosomal protein L11, mitocho 1e-35
2zkr_i165 60S ribosomal protein L12; protein-RNA complex, 60 2e-34
3iz5_J166 60S ribosomal protein L12 (L11P); eukaryotic ribos 4e-34
3iz5_A216 60S ribosomal protein L1 (L1P); eukaryotic ribosom 1e-33
3cjs_B72 50S ribosomal protein L11, ribosomal protein L11 m 1e-23
1hc8_A76 Ribosomal protein L11; ribosome, ribosomal RNA, te 1e-21
1qa6_A67 Ribosomal protein L11; ribosomal RNA, tertiary str 2e-20
2ov7_A137 50S ribosomal protein L1; 2.30A {Thermus thermophi 2e-14
1wib_A92 60S ribosomal protein L12; N-terminal domain, stru 1e-06
>2wwq_5 50S ribosomal protein L1; ribosomal protein, ribonucleoprotein, nucleotide-binding, protein biosynthesis, translation, zinc-finger; HET: 5MU; 5.80A {Escherichia coli} PDB: 3fik_5 3izt_C* 3izu_C* 3j01_5 3j0t_C* 3j0w_C* 3j0y_C* 3j11_C* 3j12_C* 3j14_C* 3kcr_5 2rdo_9 2gya_2 2gyc_2 Length = 234 Back     alignment and structure
 Score =  196 bits (501), Expect = 1e-62
 Identities = 75/148 (50%), Positives = 108/148 (72%)

Query: 140 FDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIY 199
            D  K Y  + AI L+KE ATAKF ES+D++++L ++ ++SDQ VRG+ VLP  TG+ + 
Sbjct: 15  VDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVR 74

Query: 200 IAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIVSSLGKILGPK 259
           +A F      E AK AGA++VGMEDLA +IK  E++ D+VIASP++M +V  LG++LGP+
Sbjct: 75  VAVFTQGANAEAAKAAGAELVGMEDLADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPR 134

Query: 260 GLMPNIKDGTLNSDILTAIKNAKSGQIR 287
           GLMPN K GT+  ++  A+KNAK+GQ+R
Sbjct: 135 GLMPNPKVGTVTPNVAEAVKNAKAGQVR 162
>3bbo_D Ribosomal protein L1; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 352 Back     alignment and structure
>4f9t_A 50S ribosomal protein L1; rossman fold, RNA; HET: MPD; 1.46A {Thermus thermophilus} PDB: 3u4m_A 1eg0_N 1vsp_A 2hgj_C 2hgq_C 2hgu_C 1vsa_A 4abs_C 3zvp_C 1zho_A 1ml5_c* 1yl3_C 1giy_C 2hw8_A 2j01_C 2j03_C 2jl6_C 2jl8_C 2om7_K* 2v47_C ... Length = 229 Back     alignment and structure
>3qoy_A 50S ribosomal protein L1; beta-alpha-beta, structural constituent of ribosome, rRNA BI regulation of translation, translation, ribosomal RNA; 2.10A {Aquifex aeolicus} Length = 242 Back     alignment and structure
>1vq8_I 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: a.4.7.1 PDB: 1vq4_I* 1vq5_I* 1vq6_I* 1vq7_I* 1s72_I* 1vq9_I* 1vqk_I* 1vql_I* 1vqm_I* 1vqn_I* 1vqo_I* 1vqp_I* 1yhq_I* 1yi2_I* 1yij_I* 1yit_I* 1yj9_I* 1yjn_I* 1yjw_I* 2otl_I* ... Length = 162 Back     alignment and structure
>1mzp_A 50S ribosomal protein L1P; ribosome, RNA-protein complex; 2.65A {Sulfolobus acidocaldarius} SCOP: e.24.1.1 PDB: 1pnu_5 1pny_5 1vor_7 1vou_7 1vow_7 1voy_7 1vp0_7 3e1b_Z 3e1d_Z Length = 217 Back     alignment and structure
>3bbo_K Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 224 Back     alignment and structure
>3r8s_I 50S ribosomal protein L11; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* 2qbe_I 2qbg_I 2qbi_I* 2qbk_I* 2qov_I 2qox_I 2qoz_I* 2qp1_I* 2rdo_I 2vhm_I ... Length = 141 Back     alignment and structure
>3egv_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase; HET: SAH 4MM; 1.75A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 2e34_A 2e35_A 2e36_A 2h8w_A 2hgj_L 2hgq_L 2hgu_L 2j01_K 2j03_K 2jl6_K 2jl8_K 2klm_A 2nxn_B 2wh2_K 2wh4_K 2wrj_K 2wrl_K 2x9s_K 2x9u_K 2xtg_K ... Length = 146 Back     alignment and structure
>1i2a_A 50S ribosomal protein L1P; primary rRNA-binding protein, translation repressor, ribosome; 1.85A {Methanocaldococcus jannaschii} SCOP: e.24.1.1 PDB: 1cjs_A 1u63_A 1dwu_A Length = 219 Back     alignment and structure
>2zkr_5 60S ribosomal protein L10A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 212 Back     alignment and structure
>1mms_A Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrep; 2.57A {Thermotoga maritima} SCOP: a.4.7.1 d.47.1.1 PDB: 1mvr_L 1oln_A* 1giy_L 1mj1_L* 1ml5_l* 1yl3_L 2b66_K 2b9n_K 2b9p_K 2jq7_A* 2k3f_A 1eg0_K 1jqm_A 1jqs_A 1jqt_A 1r2w_A 1r2x_A 487d_L 1pn8_L 1pn7_L Length = 140 Back     alignment and structure
>2ftc_A Mitochondrial ribosomal protein L1; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} Length = 189 Back     alignment and structure
>3o58_A L10A, 60S ribosomal protein L1; ribosomal RNA and proteins, ribosome; 4.00A {Saccharomyces cerevisiae} PDB: 3izc_A 3izs_A 1s1i_A 3o5h_A 2noq_G 3j0l_B 3j0o_B 3j0p_B 3j0q_B 3jyw_A Length = 217 Back     alignment and structure
>2ftc_G L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_G Length = 145 Back     alignment and structure
>2zkr_i 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3izc_J 3izs_J 3j16_H* 3o5h_L 3jyw_K 1s1i_K Length = 165 Back     alignment and structure
>3cjs_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 3cju_B* 2bcw_A Length = 72 Back     alignment and structure
>1hc8_A Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1y39_A* 1aci_A 1fow_A 1fox_A 1foy_A 2fow_A Length = 76 Back     alignment and structure
>1qa6_A Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1c04_C Length = 67 Back     alignment and structure
>2ov7_A 50S ribosomal protein L1; 2.30A {Thermus thermophilus} PDB: 2oum_A 2vpl_A Length = 137 Back     alignment and structure
>1wib_A 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus} SCOP: d.47.1.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
1mms_A140 Protein (ribosomal protein L11); RNA-protein compl 100.0
2ftc_G145 L11MT, MRP-L11, 39S ribosomal protein L11, mitocho 100.0
1vq8_I162 50S ribosomal protein L11P; ribosome 50S, protein- 100.0
3j21_H164 50S ribosomal protein L11P; archaea, archaeal, KIN 100.0
3egv_B146 50S ribosomal protein L11, ribosomal protein L11 m 100.0
3bbo_K224 Ribosomal protein L11; large ribosomal subunit, sp 100.0
3r8s_I141 50S ribosomal protein L11; protein biosynthesis, R 100.0
2zkr_i165 60S ribosomal protein L12; protein-RNA complex, 60 100.0
3iz5_J166 60S ribosomal protein L12 (L11P); eukaryotic ribos 100.0
3u42_A229 50S ribosomal protein L1; rossmann fold, rRNA bind 100.0
3qoy_A242 50S ribosomal protein L1; beta-alpha-beta, structu 100.0
2wwq_5234 50S ribosomal protein L1; ribosomal protein, ribon 100.0
3bbo_D352 Ribosomal protein L1; large ribosomal subunit, spi 100.0
3j21_A216 50S ribosomal protein L1P; archaea, archaeal, KINK 100.0
2zkr_5212 60S ribosomal protein L10A; protein-RNA complex, 6 100.0
1i2a_A219 50S ribosomal protein L1P; primary rRNA-binding pr 100.0
1mzp_A217 50S ribosomal protein L1P; ribosome, RNA-protein c 100.0
2ftc_A189 Mitochondrial ribosomal protein L1; mitochondrial 99.98
3iz5_A216 60S ribosomal protein L1 (L1P); eukaryotic ribosom 99.97
1wib_A92 60S ribosomal protein L12; N-terminal domain, stru 99.97
3cjs_B72 50S ribosomal protein L11, ribosomal protein L11 m 99.97
1hc8_A76 Ribosomal protein L11; ribosome, ribosomal RNA, te 99.97
3o58_A217 L10A, 60S ribosomal protein L1; ribosomal RNA and 99.96
1qa6_A67 Ribosomal protein L11; ribosomal RNA, tertiary str 99.94
2ov7_A137 50S ribosomal protein L1; 2.30A {Thermus thermophi 99.13
>1mms_A Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrep; 2.57A {Thermotoga maritima} SCOP: a.4.7.1 d.47.1.1 PDB: 1mvr_L 1oln_A* 1giy_L 1mj1_L* 1ml5_l* 1yl3_L 2b66_K 2b9n_K 2b9p_K 2jq7_A* 2k3f_A 1eg0_K 1jqm_A 1jqs_A 1jqt_A 1r2w_A 1r2x_A 487d_L 1pn8_L 1pn7_L Back     alignment and structure
Probab=100.00  E-value=8.2e-59  Score=388.56  Aligned_cols=140  Identities=59%  Similarity=0.909  Sum_probs=131.9

Q ss_pred             ccceeEEEEEEeecccCCCCCCCCcccCCCCCChHHHHHHHHHHhcCCcCCCceeEEEEEecCCeEEEEEeCCChHHHHH
Q psy15220          2 VKKITGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKNFNAQTQGIELGTPIPVIITVFSDKSFTFKKKVTPVTFLIK   81 (289)
Q Consensus         2 ~k~~~~~i~l~v~~G~a~p~pplgp~LG~~Gin~~~f~k~fN~~T~~~~~g~~vpv~i~v~~drsf~~~v~~Pp~s~ll~   81 (289)
                      ||++.++|+|+++||+|+|+|||||+|||+|||+|+||++||++|++|+ |++|||+||||+||||+|++++||+||||+
T Consensus         1 ~k~~~~~ikL~v~aG~A~p~PplgPaLG~~Gvni~~fck~fN~~T~~~~-G~~ipV~itv~~drsf~f~vk~Ppas~Ll~   79 (140)
T 1mms_A            1 AKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKA-GMILPVVITVYEDKSFTFIIKTPPASFLLK   79 (140)
T ss_dssp             ------CEEEEEETTCCCCTTTTTHHHHTTTCCHHHHHHHHHHHTTTSC-SSEEEEEEEECTTSCEEEEECCCCHHHHHH
T ss_pred             CCceEEEEEEEEecCcccCCCCccccccccCCCHHHHHHHHHHHhhhcC-CCeEEEEEEEcCCCeEEEEEcCCCHHHHHH
Confidence            5788999999999999999999999999999999999999999999995 999999999999999999999999999999


Q ss_pred             HHhCCCCCCCCCCCceeecccHHHHHHHHHhhhhccchhhHHHHHHHhhhcccccceeccc
Q psy15220         82 KAAGIQKGSAKPHSDKVGKLTYLQIKEIATIKNVDLTAASISAAMRTIAGSARSMGIIFDK  142 (289)
Q Consensus        82 ka~g~~~g~~~~~~~~~g~it~~~v~eIA~~k~~d~~~~~l~~~vk~v~Gta~smGi~V~~  142 (289)
                      ||+|+++||++|+++|+|+||++||||||+.|++|+++.+|+++||+|+||||||||+|++
T Consensus        80 ka~g~~~gs~~p~k~~vG~it~~qi~eIA~~K~~dl~a~~l~~a~k~I~GTArSmGi~V~g  140 (140)
T 1mms_A           80 KAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD  140 (140)
T ss_dssp             HHHTCSSCCSSTTTSCCEEECHHHHHHHHHHHGGGCCCSSHHHHHHHHHHHHTTTTEEEC-
T ss_pred             HHhCCCCCCCCCCCeEeeeEcHHHHHHHHHHHHHhhccccHHHHHHHHHHHHHcCeeEeeC
Confidence            9999999999999999999999999999999999999999999999999999999999985
>2ftc_G L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_G Back     alignment and structure
>1vq8_I 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: a.4.7.1 PDB: 1vq4_I* 1vq5_I* 1vq6_I* 1vq7_I* 1s72_I* 1vq9_I* 1vqk_I* 1vql_I* 1vqm_I* 1vqn_I* 1vqo_I* 1vqp_I* 1yhq_I* 1yi2_I* 1yij_I* 1yit_I* 1yj9_I* 1yjn_I* 1yjw_I* 2otl_I* ... Back     alignment and structure
>3j21_H 50S ribosomal protein L11P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3egv_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase; HET: SAH 4MM; 1.75A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 2e34_A 2e35_A 2e36_A 2h8w_A 2hgj_L 2hgq_L 2hgu_L 2j01_K 2j03_K 2jl6_K 2jl8_K 2klm_A 2nxn_B 2wh2_K 2wh4_K 2wrj_K 2wrl_K 2x9s_K 2x9u_K 2xtg_K ... Back     alignment and structure
>3bbo_K Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>3r8s_I 50S ribosomal protein L11; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* 2qbe_I 2qbg_I 2qbi_I* 2qbk_I* 2qov_I 2qox_I 2qoz_I* 2qp1_I* 2rdo_I 2vhm_I ... Back     alignment and structure
>2zkr_i 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3izc_J 3izs_J 3j16_H* 3o5h_L 3jyw_K 1s1i_K Back     alignment and structure
>3u42_A 50S ribosomal protein L1; rossmann fold, rRNA binding, RNA binding; 1.35A {Thermus thermophilus} PDB: 3u56_A 3u4m_A 1eg0_N 1vsp_A 2hgj_C 2hgq_C 2hgu_C 1vsa_A 4f9t_A* 4abs_C 3zvp_C 1zho_A 1ml5_c* 1yl3_C 1giy_C 3umy_A 2hw8_A 2j01_C 2j03_C 2om7_K* ... Back     alignment and structure
>3qoy_A 50S ribosomal protein L1; beta-alpha-beta, structural constituent of ribosome, rRNA BI regulation of translation, translation, ribosomal RNA; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2wwq_5 50S ribosomal protein L1; ribosomal protein, ribonucleoprotein, nucleotide-binding, protein biosynthesis, translation, zinc-finger; HET: 5MU; 5.80A {Escherichia coli} PDB: 3fik_5 3izt_C* 3izu_C* 3j01_5 3j0t_C* 3j0w_C* 3j0y_C* 3j11_C* 3j12_C* 3j14_C* 3kcr_5 2rdo_9 2gya_2 2gyc_2 Back     alignment and structure
>3bbo_D Ribosomal protein L1; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3j21_A 50S ribosomal protein L1P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2zkr_5 60S ribosomal protein L10A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1i2a_A 50S ribosomal protein L1P; primary rRNA-binding protein, translation repressor, ribosome; 1.85A {Methanocaldococcus jannaschii} SCOP: e.24.1.1 PDB: 1cjs_A 1u63_A 1dwu_A Back     alignment and structure
>1mzp_A 50S ribosomal protein L1P; ribosome, RNA-protein complex; 2.65A {Sulfolobus acidocaldarius} SCOP: e.24.1.1 PDB: 1pnu_5 1pny_5 1vor_7 1vou_7 1vow_7 1voy_7 1vp0_7 3e1b_Z 3e1d_Z Back     alignment and structure
>2ftc_A Mitochondrial ribosomal protein L1; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} Back     alignment and structure
>1wib_A 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus} SCOP: d.47.1.1 Back     alignment and structure
>3cjs_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 3cju_B* 2bcw_A Back     alignment and structure
>1hc8_A Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1y39_A* 1aci_A 1fow_A 1fox_A 1foy_A 2fow_A Back     alignment and structure
>3o58_A L10A, 60S ribosomal protein L1; ribosomal RNA and proteins, ribosome; 4.00A {Saccharomyces cerevisiae} PDB: 3izc_A 1s1i_A 3izs_A 3o5h_A 2noq_G 3j0l_B 3j0o_B 3j0p_B 3j0q_B 3jyw_A Back     alignment and structure
>1qa6_A Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1c04_C Back     alignment and structure
>2ov7_A 50S ribosomal protein L1; 2.30A {Thermus thermophilus} PDB: 2oum_A 2vpl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1ad2a_224 e.24.1.1 (A:) Ribosomal protein L1 {Thermus thermo 4e-34
d2gycg271 d.47.1.1 (G:2-72) Ribosomal protein L11, N-termina 9e-33
d3cjsb170 d.47.1.1 (B:1-70) Ribosomal protein L11, N-termina 8e-30
d1mmsa263 d.47.1.1 (A:8-70) Ribosomal protein L11, N-termina 5e-28
d1hc8a_74 a.4.7.1 (A:) Ribosomal protein L11, C-terminal dom 4e-25
d1wiba_92 d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mu 5e-24
d2gycg168 a.4.7.1 (G:73-140) Ribosomal protein L11, C-termin 1e-23
d1vqoi170 a.4.7.1 (I:71-140) Ribosomal protein L11, C-termin 6e-23
d3cjrb167 a.4.7.1 (B:71-137) Ribosomal protein L11, C-termin 6e-23
d1mmsa170 a.4.7.1 (A:71-140) Ribosomal protein L11, C-termin 4e-22
d1mzpa_217 e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Sulfo 2e-17
d1i2aa_212 e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Metha 2e-16
>d1ad2a_ e.24.1.1 (A:) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} Length = 224 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Ribosomal protein L1
superfamily: Ribosomal protein L1
family: Ribosomal protein L1
domain: Ribosomal protein L1
species: Thermus thermophilus [TaxId: 274]

 Score =  121 bits (305), Expect = 4e-34
 Identities = 68/149 (45%), Positives = 99/149 (66%), Gaps = 1/149 (0%)

Query: 140 FDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIY 199
            D NKIY+ D A  L+KE ATAKFDE++++   L ++ +RSDQ VRG++ LP   GK++ 
Sbjct: 10  VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVR 69

Query: 200 IAAFVPKEKYEQAKIAGADIVGMEDLAQKIKSNEVSCDLVIASPESMHIV-SSLGKILGP 258
           + A    EK ++A+ AGAD VG E++ QKI    +  D V+A+P+ M  V S LG+ILGP
Sbjct: 70  VLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGP 129

Query: 259 KGLMPNIKDGTLNSDILTAIKNAKSGQIR 287
           +GL+PN K GT+  +I   I+  K+G+I 
Sbjct: 130 RGLLPNPKAGTVGFNIGEIIREIKAGRIE 158
>d2gycg2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 71 Back     information, alignment and structure
>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 70 Back     information, alignment and structure
>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 63 Back     information, alignment and structure
>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 74 Back     information, alignment and structure
>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d2gycg1 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure
>d1vqoi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 70 Back     information, alignment and structure
>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 67 Back     information, alignment and structure
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 70 Back     information, alignment and structure
>d1mzpa_ e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 217 Back     information, alignment and structure
>d1i2aa_ e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 212 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1ad2a_224 Ribosomal protein L1 {Thermus thermophilus [TaxId: 100.0
d1mzpa_217 Ribosomal protein L1 {Archaeon Sulfolobus acidocal 100.0
d1i2aa_212 Ribosomal protein L1 {Archaeon Methanococcus janna 100.0
d3cjsb170 Ribosomal protein L11, N-terminal domain {Thermus 99.97
d2gycg271 Ribosomal protein L11, N-terminal domain {Escheric 99.97
d1wiba_92 60S ribosomal protein L12 {Mouse (Mus musculus) [T 99.96
d1mmsa263 Ribosomal protein L11, N-terminal domain {Thermoto 99.96
d1hc8a_74 Ribosomal protein L11, C-terminal domain {Bacillus 99.96
d1mmsa170 Ribosomal protein L11, C-terminal domain {Thermoto 99.95
d1vqoi170 Ribosomal protein L11, C-terminal domain {Archaeon 99.95
d1xbpg172 Ribosomal protein L11, C-terminal domain {Deinococ 99.95
d2gycg168 Ribosomal protein L11, C-terminal domain {Escheric 99.93
d3cjrb167 Ribosomal protein L11, C-terminal domain {Thermus 99.92
>d1ad2a_ e.24.1.1 (A:) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Ribosomal protein L1
superfamily: Ribosomal protein L1
family: Ribosomal protein L1
domain: Ribosomal protein L1
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=8.7e-44  Score=317.89  Aligned_cols=149  Identities=46%  Similarity=0.709  Sum_probs=144.9

Q ss_pred             cccccccchhHHHHHHHHhhccccCCceeEEEEEEeeecCCCceeeeEEEcCCCCCCceEEEEecCcccHHHHHHcCCCe
Q psy15220        140 FDKNKIYSFDSAITLIKEAATAKFDESIDISIHLNVNIKRSDQIVRGSIVLPFSTGKKIYIAAFVPKEKYEQAKIAGADI  219 (289)
Q Consensus       140 V~~k~~ysl~eAi~~ik~~~~gkFdesVe~~i~l~vd~kk~~~~~rg~v~LP~~~~k~~kI~Vfa~~~~~~~Ak~aGa~~  219 (289)
                      ++....|+++||++++|+.+.++|+|+||++|+|++|.+++++++||+|.|||+++++.+|||||+++.+++|+++||++
T Consensus        10 ~d~~k~ysi~EAi~~lk~~~~~kF~esvel~i~L~~~~~k~~~~i~g~v~LP~~~~k~~ki~v~~~~e~~~~Ak~aGa~~   89 (224)
T d1ad2a_          10 VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADY   89 (224)
T ss_dssp             CCTTCCBCHHHHHHHHHTTCCSSSCCEEEEEEEESSCTTCGGGCCEEEEECSSSCSTTSCEEEECCTHHHHHHHHTTCSE
T ss_pred             cCccCCcCHHHHHHHHHHcCCCCCCceEEEEEEEcccccccccccceeEEeccccccceeEEEecchHHHHHHHhcCccc
Confidence            56667899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecchHHHHHHHccCccccEEEECccchHHH-HhhccccCCCCCCCCCCCCCCCccHHHHHHHHhccceee
Q psy15220        220 VGMEDLAQKIKSNEVSCDLVIASPESMHIV-SSLGKILGPKGLMPNIKDGTLNSDILTAIKNAKSGQIRS  288 (289)
Q Consensus       220 vG~~eLi~~Ik~~~~~~d~~iat~d~m~~l-~~lg~iLGprGlMP~~k~GTv~~di~~~v~~~k~G~~~~  288 (289)
                      +|++||+++|++|+.+||+|||||+|||.| +.|||+||||||||||+.||+++|+.++|+++|+|+++|
T Consensus        90 vg~~eli~ki~~~~~~fd~~ia~~~~m~~v~~~lgriLGprGlMP~pk~Gtv~~di~~~v~~~k~g~v~~  159 (224)
T d1ad2a_          90 VGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEF  159 (224)
T ss_dssp             EECGGGHHHHHTTCCCCSEEEECGGGHHHHHHHHHHHHHHHTCSCCTTTTCBCSCHHHHHHHHHTTEEEE
T ss_pred             cCcHHHHHHHhcCCccchhHHhHHHHHHHHHHhhhhccCcccCCCCCCCCCcchhHHHHHHHHhCCeEEE
Confidence            999999999999999999999999999999 689999999999999999999999999999999999987
>d1mzpa_ e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1i2aa_ e.24.1.1 (A:) Ribosomal protein L1 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gycg2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vqoi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1xbpg1 a.4.7.1 (G:72-143) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gycg1 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure