Diaphorina citri psyllid: psy15226

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--

MVGTLAILLIGNHVSYNSLNIALSILPVIFFILFSFVPETPHFHAAKNNLKKTEKSLKWYRGNKKDVMEEMNSIMDKTQEDLKSKTGYLELLTNKSNRRAFTLVMAASLFQRLGGITSMITYSSTLLPKLDNAYFGPDQCILVFMIIMFLSNFLQAPLMDILGRKPLSCFSAALGCLLTFSTGLFYLYQGELPNFQYIPYITTLLYAASYYGIGCLPNILVSELFPINVRCQASSCASVALAFGSFITTKFHILITKSLGQHVIFFIYSSVHFCSVVFNYFYLMETKQKTLAEIQESIMNSHKQLRREKTSPFECGFDPISKPRISYSLHFFSIALIFLIFDIEITLIFPSPLIKQKIIIVN

cEEEEHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHEEEcc

MVGTLAILLIGNHVSYNSLNIALSILPVIFFILFSFVPETPHFHAAKNNLKKTEKSLKWYRGNKKDVMEEMN**************GYLELLTNKSNRRAFTLVMAASLFQRLGGITSMITYSSTLLPKLDNAYFGPDQCILVFMIIMFLSNFLQAPLMDILGRKPLSCFSAALGCLLTFSTGLFYLYQGELPNFQYIPYITTLLYAASYYGIGCLPNILVSELFPINVRCQASSCASVALAFGSFITTKFHILITKSLGQHVIFFIYSSVHFCSVVFNYFYLMETKQKTLAEIQ*******************CGFDPISKPRISYSLHFFSIALIFLIFDIEITLIFPSPLIKQKIIIVN

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008643 [BP]	carbohydrate transport	probable	GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0006979 [BP]	response to oxidative stress	probable	GO:0006950, GO:0008150, GO:0050896
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071385 [BP]	cellular response to glucocorticoid stimulus	probable	GO:0051384, GO:0071383, GO:0071384, GO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0033993, GO:0071310, GO:0014070, GO:0071495, GO:0031960, GO:0009987, GO:0071396, GO:0032870, GO:0008150, GO:0042221, GO:0010033, GO:0009725, GO:0050896, GO:0071407, GO:0044763, GO:0048545
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 14-300
View the alignment between query and template
View the model in PyMOL

Template: 3RKO, chain A
Confidence level:confident
Coverage over the Query: 323-355
View the alignment between query and template
View the model in PyMOL