Diaphorina citri psyllid: psy15231


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MYLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcc
*Y****EPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-ubiquinone oxidoreductase chain 1 Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO78703
NADH-ubiquinone oxidoreductase chain 1 Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentP18929
NADH-ubiquinone oxidoreductase chain 1 Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ9TA29

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HE8, chain H
Confidence level:probable
Coverage over the Query: 10-45,84-99
View the alignment between query and template
View the model in PyMOL