Psyllid ID: psy15231


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MYLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHEEEEccccccccccHHHHHHHHHHHHHHHHHc
mylmgfepgpvdrnamsgtesrthtttcehsGVAFLTLLERKVLSFIQlrkgpnkrgvigifqpFSDAIKLYTKEffiplksndypywvtPLISLGVSLGT
mylmgfepgpvdrnAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFiqlrkgpnkrgvIGIFQPFSDAIKLYTKEFFIPlksndypyWVTPLISLGVSLGT
MYLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
**************************TCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGV****
*Y****EPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
MYLMGFEPGPVDRNAM***********CEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
*YLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
SSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLMGFEPGPVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPLISLGVSLGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
B0FWD8 313 NADH-ubiquinone oxidoredu N/A N/A 0.732 0.236 0.608 2e-18
P51930163 NADH-ubiquinone oxidoredu N/A N/A 0.732 0.453 0.608 5e-18
P33502 314 NADH-ubiquinone oxidoredu N/A N/A 0.732 0.235 0.608 5e-18
P84301163 NADH-ubiquinone oxidoredu N/A N/A 0.712 0.441 0.625 6e-18
P51926163 NADH-ubiquinone oxidoredu N/A N/A 0.712 0.441 0.625 6e-18
P84300163 NADH-ubiquinone oxidoredu N/A N/A 0.712 0.441 0.625 6e-18
P51938163 NADH-ubiquinone oxidoredu N/A N/A 0.732 0.453 0.608 6e-18
P34846 314 NADH-ubiquinone oxidoredu yes N/A 0.732 0.235 0.608 6e-18
P84302163 NADH-ubiquinone oxidoredu N/A N/A 0.712 0.441 0.625 7e-18
P51931163 NADH-ubiquinone oxidoredu N/A N/A 0.712 0.441 0.625 7e-18
>sp|B0FWD8|NU1M_AEDAE NADH-ubiquinone oxidoreductase chain 1 OS=Aedes aegypti GN=mt:ND1 PE=3 SV=1 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 55/74 (74%)

Query: 26 TTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDY 85
            C   GVAFLTLLERKVL +IQ+RKGPNK G +G+ QPFSDA+KL+TKE   PL SN  
Sbjct: 14 VICVMVGVAFLTLLERKVLGYIQIRKGPNKVGFMGLLQPFSDAVKLFTKEQTYPLLSNYI 73

Query: 86 PYWVTPLISLGVSL 99
           Y+ +P+ SL +SL
Sbjct: 74 FYYFSPIFSLFLSL 87




Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Aedes aegypti (taxid: 7159)
EC: 1EC: .EC: 6EC: .EC: 5EC: .EC: 3
>sp|P51930|NU1M_DROBF NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila bifasciata GN=mt:ND1 PE=3 SV=2 Back     alignment and function description
>sp|P33502|NU1M_ANOQU NADH-ubiquinone oxidoreductase chain 1 OS=Anopheles quadrimaculatus GN=ND1 PE=3 SV=1 Back     alignment and function description
>sp|P84301|NU1M_DROAL NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila algonquin GN=mt:ND1 PE=3 SV=1 Back     alignment and function description
>sp|P51926|NU1M_DROAI NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila affinis GN=mt:ND1 PE=3 SV=2 Back     alignment and function description
>sp|P84300|NU1M_DROAZ NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila azteca GN=mt:ND1 PE=3 SV=1 Back     alignment and function description
>sp|P51938|NU1M_DROSS NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila subsilvestris GN=mt:ND1 PE=3 SV=2 Back     alignment and function description
>sp|P34846|NU1M_ANOGA NADH-ubiquinone oxidoreductase chain 1 OS=Anopheles gambiae GN=mt:ND1 PE=3 SV=1 Back     alignment and function description
>sp|P84302|NU1M_DROTR NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila tristis GN=mt:ND1 PE=3 SV=1 Back     alignment and function description
>sp|P51931|NU1M_DROGU NADH-ubiquinone oxidoreductase chain 1 (Fragments) OS=Drosophila guanche GN=mt:ND1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
407914474 304 NADH dehydrogenase subunit 1 (mitochondr 0.673 0.223 0.735 2e-24
51243165 304 NADH dehydrogenase subunit 1 [Bactericer 0.673 0.223 0.735 2e-24
51243168 305 NADH dehydrogenase subunit 1 [Calophya s 0.673 0.222 0.720 6e-23
51830075 304 NADH dehydrogenase subunit 1 [Pachypsyll 0.673 0.223 0.720 1e-20
46575802 312 NADH dehydrogenase subunit 1 (mitochondr 0.782 0.253 0.632 5e-19
371591209 312 NADH dehydrogenase subunit 1 (mitochondr 0.782 0.253 0.632 5e-19
371591221 312 NADH dehydrogenase subunit 1 (mitochondr 0.782 0.253 0.632 5e-19
360040810 312 NADH dehydrogenase subunit 1 (mitochondr 0.782 0.253 0.632 8e-19
12642516129 NADH dehydrogenase subunit 1 [Euphausia 0.782 0.612 0.632 8e-19
8489064 308 NADH dehydrogenase subunit 1 (mitochondr 0.782 0.256 0.620 8e-19
>gi|407914474|gb|AFU51375.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914477|gb|AFU51377.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914480|gb|AFU51379.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914483|gb|AFU51381.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914486|gb|AFU51383.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914489|gb|AFU51385.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] gi|407914492|gb|AFU51387.1| NADH dehydrogenase subunit 1 (mitochondrion) [Bactericera cockerelli] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/68 (73%), Positives = 62/68 (91%)

Query: 32 GVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTP 91
          GVAFLTLLERK+L ++QLRKGPNK GV+G+FQPFSDAIKLYTKE+F PLKSN YPYW++P
Sbjct: 18 GVAFLTLLERKILGYVQLRKGPNKVGVLGLFQPFSDAIKLYTKEYFFPLKSNFYPYWISP 77

Query: 92 LISLGVSL 99
          ++ L +S+
Sbjct: 78 IVILSISV 85




Source: Bactericera cockerelli

Species: Bactericera cockerelli

Genus: Bactericera

Family: Triozidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|51243165|gb|AAT99378.1| NADH dehydrogenase subunit 1 [Bactericera cockerelli] Back     alignment and taxonomy information
>gi|51243168|gb|AAT99380.1| NADH dehydrogenase subunit 1 [Calophya schini] Back     alignment and taxonomy information
>gi|51830075|ref|YP_073295.1| NADH dehydrogenase subunit 1 [Pachypsylla venusta] gi|37957995|gb|AAP14660.1| NADH dehydrogenase subunit 1 [Pachypsylla venusta] gi|45826293|gb|AAS77793.1| NADH dehydrogenase subunit 1 [Pachypsylla venusta] Back     alignment and taxonomy information
>gi|46575802|dbj|BAD16772.1| NADH dehydrogenase subunit 1 (mitochondrion) [Euphausia superba] gi|197940783|gb|ACH78215.1| NADH dehydrogenase subunit 1 [Euphausia superba] Back     alignment and taxonomy information
>gi|371591209|gb|AEX54951.1| NADH dehydrogenase subunit 1 (mitochondrion) [Euphausia superba] Back     alignment and taxonomy information
>gi|371591221|gb|AEX54962.1| NADH dehydrogenase subunit 1 (mitochondrion) [Euphausia superba] Back     alignment and taxonomy information
>gi|360040810|gb|AEV91684.1| NADH dehydrogenase subunit 1 (mitochondrion) [Euphausia pacifica] Back     alignment and taxonomy information
>gi|12642516|gb|AAK00267.1|AF281263_1 NADH dehydrogenase subunit 1 [Euphausia superba] Back     alignment and taxonomy information
>gi|8489064|gb|AAF75585.1|AF149775_2 NADH dehydrogenase subunit 1 (mitochondrion) [Meganyctiphanes norvegica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
FB|FBgn0013679 312 mt:ND1 "mitochondrial NADH-ubi 0.712 0.230 0.625 7.5e-18
UNIPROTKB|P92604 318 MT-ND1 "NADH-ubiquinone oxidor 0.663 0.210 0.522 5.1e-13
UNIPROTKB|P03887 318 MT-ND1 "NADH-ubiquinone oxidor 0.663 0.210 0.522 1.1e-12
UNIPROTKB|Q6QTH1 318 ND1 "NADH-ubiquinone oxidoredu 0.663 0.210 0.522 1.1e-12
UNIPROTKB|O79874 318 MT-ND1 "NADH-ubiquinone oxidor 0.663 0.210 0.507 1.1e-12
TIGR_CMR|ECH_0617 367 ECH_0617 "NADH dehydrogenase I 0.663 0.182 0.492 1.7e-12
TIGR_CMR|APH_0711 340 APH_0711 "NADH dehydrogenase I 0.663 0.197 0.477 3e-12
MGI|MGI:101787 318 mt-Nd1 "mitochondrially encode 0.663 0.210 0.507 4e-12
UNIPROTKB|H9KVF8 318 7066247 "NADH-ubiquinone oxido 0.663 0.210 0.507 4e-12
UNIPROTKB|P18936 324 MT-ND1 "NADH-ubiquinone oxidor 0.663 0.206 0.477 5.6e-12
FB|FBgn0013679 mt:ND1 "mitochondrial NADH-ubiquinone oxidoreductase chain 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 7.5e-18, P = 7.5e-18
 Identities = 45/72 (62%), Positives = 55/72 (76%)

Query:    28 CEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPY 87
             C    VAFLTLLERKVL +IQ+RKGPNK G++GI QPF DAIKL+TKE   PL SN   Y
Sbjct:    16 CVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSY 75

Query:    88 WVTPLISLGVSL 99
             +++P+ SL +SL
Sbjct:    76 YISPIFSLFLSL 87




GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=NAS
GO:0005747 "mitochondrial respiratory chain complex I" evidence=NAS
GO:0005739 "mitochondrion" evidence=NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016020 "membrane" evidence=IEA
UNIPROTKB|P92604 MT-ND1 "NADH-ubiquinone oxidoreductase chain 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P03887 MT-ND1 "NADH-ubiquinone oxidoreductase chain 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QTH1 ND1 "NADH-ubiquinone oxidoreductase chain 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O79874 MT-ND1 "NADH-ubiquinone oxidoreductase chain 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0617 ECH_0617 "NADH dehydrogenase I, H subunit" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0711 APH_0711 "NADH dehydrogenase I, H subunit" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
MGI|MGI:101787 mt-Nd1 "mitochondrially encoded NADH dehydrogenase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H9KVF8 7066247 "NADH-ubiquinone oxidoreductase chain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P18936 MT-ND1 "NADH-ubiquinone oxidoreductase chain 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P18929NU1M_DROME1, ., 6, ., 5, ., 30.6250.71280.2307yesN/A
O78703NU1M_MONDO1, ., 6, ., 5, ., 30.54410.67320.2138yesN/A
Q37717NU1M_ORNAN1, ., 6, ., 5, ., 30.51470.67320.2138yesN/A
P34846NU1M_ANOGA1, ., 6, ., 5, ., 30.60810.73260.2356yesN/A
Q9TA29NU1M_LOXAF1, ., 6, ., 5, ., 30.51470.67320.2138yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
MTH00193 306 MTH00193, ND1, NADH dehydrogenase subunit 1; Provi 2e-33
MTH00143 307 MTH00143, ND1, NADH dehydrogenase subunit 1; Provi 8e-30
MTH00225 305 MTH00225, ND1, NADH dehydrogenase subunit 1; Provi 1e-27
MTH00218 311 MTH00218, ND1, NADH dehydrogenase subunit 1; Provi 2e-23
pfam00146 309 pfam00146, NADHdh, NADH dehydrogenase 3e-22
MTH00195 307 MTH00195, ND1, NADH dehydrogenase subunit 1; Provi 2e-21
MTH00054 324 MTH00054, ND1, NADH dehydrogenase subunit 1; Provi 1e-20
MTH00216 327 MTH00216, ND1, NADH dehydrogenase subunit 1; Provi 3e-20
MTH00040 323 MTH00040, ND1, NADH dehydrogenase subunit 1; Valid 8e-20
MTH00104 318 MTH00104, ND1, NADH dehydrogenase subunit 1; Provi 8e-20
MTH00111 323 MTH00111, ND1, NADH dehydrogenase subunit 1; Provi 2e-19
MTH00010 311 MTH00010, ND1, NADH dehydrogenase subunit 1; Valid 2e-19
MTH00134 324 MTH00134, ND1, NADH dehydrogenase subunit 1; Provi 2e-17
MTH00071 322 MTH00071, ND1, NADH dehydrogenase subunit 1; Provi 1e-16
COG1005 332 COG1005, NuoH, NADH:ubiquinone oxidoreductase subu 2e-16
PRK06076 322 PRK06076, PRK06076, NADH:ubiquinone oxidoreductase 6e-16
MTH00029 343 MTH00029, ND1, NADH dehydrogenase subunit 1; Provi 3e-15
MTH00058 293 MTH00058, ND1, NADH dehydrogenase subunit 1; Provi 1e-14
MTH00090 284 MTH00090, ND1, NADH dehydrogenase subunit 1; Provi 1e-13
CHL00032 363 CHL00032, ndhA, NADH dehydrogenase subunit 1 2e-07
COG0650 309 COG0650, HyfC, Formate hydrogenlyase subunit 4 [En 6e-07
>gnl|CDD|177241 MTH00193, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
 Score =  116 bits (294), Expect = 2e-33
 Identities = 45/68 (66%), Positives = 53/68 (77%)

Query: 32 GVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTP 91
           VAFLTLLERKVL +IQ+RKGPNK G +GI QPFSDAIKL+TKE   PL SN   Y+ +P
Sbjct: 18 SVAFLTLLERKVLGYIQIRKGPNKVGFMGILQPFSDAIKLFTKEQTYPLMSNYLLYYFSP 77

Query: 92 LISLGVSL 99
          + SL +SL
Sbjct: 78 VFSLFLSL 85


Length = 306

>gnl|CDD|177201 MTH00143, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214465 MTH00225, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214463 MTH00218, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|109212 pfam00146, NADHdh, NADH dehydrogenase Back     alignment and domain information
>gnl|CDD|214452 MTH00195, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177127 MTH00054, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|164761 MTH00216, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214409 MTH00040, ND1, NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|177166 MTH00104, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214422 MTH00111, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|164586 MTH00010, ND1, NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|177192 MTH00134, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214418 MTH00071, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|223937 COG1005, NuoH, NADH:ubiquinone oxidoreductase subunit 1 (chain H) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235692 PRK06076, PRK06076, NADH:ubiquinone oxidoreductase subunit H; Provisional Back     alignment and domain information
>gnl|CDD|177108 MTH00029, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177130 MTH00058, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177153 MTH00090, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|214341 CHL00032, ndhA, NADH dehydrogenase subunit 1 Back     alignment and domain information
>gnl|CDD|223723 COG0650, HyfC, Formate hydrogenlyase subunit 4 [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
MTH00071 322 ND1 NADH dehydrogenase subunit 1; Provisional 99.92
MTH00040 323 ND1 NADH dehydrogenase subunit 1; Validated 99.92
PF00146 311 NADHdh: NADH dehydrogenase; InterPro: IPR001694 NA 99.92
MTH00195 307 ND1 NADH dehydrogenase subunit 1; Provisional 99.92
MTH00058 293 ND1 NADH dehydrogenase subunit 1; Provisional 99.92
MTH00029 343 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00134 324 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00218 311 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00111 323 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00225 305 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00193 306 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
COG1005 332 NuoH NADH:ubiquinone oxidoreductase subunit 1 (cha 99.91
MTH00143 307 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
KOG4770|consensus 315 99.91
MTH00216 327 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00104 318 ND1 NADH dehydrogenase subunit 1; Provisional 99.91
MTH00090 284 ND1 NADH dehydrogenase subunit 1; Provisional 99.9
CHL00032 363 ndhA NADH dehydrogenase subunit 1 99.9
PRK06076 322 NADH:ubiquinone oxidoreductase subunit H; Provisio 99.9
MTH00010 311 ND1 NADH dehydrogenase subunit 1; Validated 99.9
MTH00054 324 ND1 NADH dehydrogenase subunit 1; Provisional 99.9
COG0650 309 HyfC Formate hydrogenlyase subunit 4 [Energy produ 99.74
>MTH00071 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
Probab=99.92  E-value=2.6e-25  Score=174.65  Aligned_cols=87  Identities=38%  Similarity=0.550  Sum_probs=78.1

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCcCCccccchhHHHHHHHhhccccccccccchhHhHHHH
Q psy15231         13 RNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAIKLYTKEFFIPLKSNDYPYWVTPL   92 (101)
Q Consensus        13 ~~~~~~~~~~l~~~i~vl~~~~fl~~~eRKv~a~~Q~R~GP~~vg~~GllQ~~aD~lKLl~KE~i~p~~s~~~~f~~aP~   92 (101)
                      ||..+..+..+++++.++++++++++.|||++|++|+|+|||++|+.|++||++|++||++||.+.|+++|+.+|..+|+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~eRKi~a~~Q~R~GP~~vg~~GilQp~~D~~KLl~Ke~i~p~~~~~~lf~~~P~   81 (322)
T MTH00071          2 MTLISLIINPLLYIIPVLLAVAFLTLVERKVLGYMQLRKGPNIVGPMGLLQPIADGLKLFIKEPIRPSTSSQILFILMPT   81 (322)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCcCCCCcccchhHHHHHHHHhcccCcccchHHHHHHHHH
Confidence            56666666666666667778999999999999999999999999999999999999999999999999999899999999


Q ss_pred             HHHHHhh
Q psy15231         93 ISLGVSL   99 (101)
Q Consensus        93 i~~~~~l   99 (101)
                      +.++.++
T Consensus        82 l~~~~~l   88 (322)
T MTH00071         82 MALTLAL   88 (322)
T ss_pred             HHHHHHH
Confidence            9988765



>MTH00040 ND1 NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>PF00146 NADHdh: NADH dehydrogenase; InterPro: IPR001694 NADH:ubiquinone oxidoreductase (complex I) (1 Back     alignment and domain information
>MTH00195 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00058 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00029 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00134 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00218 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00111 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00225 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00193 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>COG1005 NuoH NADH:ubiquinone oxidoreductase subunit 1 (chain H) [Energy production and conversion] Back     alignment and domain information
>MTH00143 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>KOG4770|consensus Back     alignment and domain information
>MTH00216 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00104 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00090 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>CHL00032 ndhA NADH dehydrogenase subunit 1 Back     alignment and domain information
>PRK06076 NADH:ubiquinone oxidoreductase subunit H; Provisional Back     alignment and domain information
>MTH00010 ND1 NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>MTH00054 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>COG0650 HyfC Formate hydrogenlyase subunit 4 [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
4he8_H 365 Crystal Structure Of The Membrane Domain Of Respira 2e-09
>pdb|4HE8|H Chain H, Crystal Structure Of The Membrane Domain Of Respiratory Complex I From Thermus Thermophilus Length = 365 Back     alignment and structure

Iteration: 1

Score = 57.0 bits (136), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 1/90 (1%) Query: 10 PVDRNAMSGTESRTHTTTCEHSGVAFLTLLERKVLSFIQLRKGPNKRGVIGIFQPFSDAI 69 PVD M ++ + AF+TL+ER++L+ Q+R GPN+ G G+ QP +DAI Sbjct: 6 PVDPYWMVALKALL-VVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAI 64 Query: 70 KLYTKEFFIPLKSNDYPYWVTPLISLGVSL 99 K KE + +++ + + + PLIS+ +L Sbjct: 65 KSIFKEDIVVAQADRFLFVLAPLISVVFAL 94

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00