Diaphorina citri psyllid: psy15243

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MDGRMSYSKALMILILIYCYVIPWAMFPYLEKWSRFVPEGYLTSCTFDYLTPTESIRFYVLFMFIICYCIPMGMIINFYSQIVGHVFSHEKALREQAKKMNVESLRSGQKEGQSSAEVRIAKTAITLCALFVASWTPYAVVALTGAFGDQ
ccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccc
******YSKALMILILIYCYVIPWAMFPYLEKWSRFVPEGYLTSCTFDYLTPTESIRFYVLFMFIICYCIPMGMIINFYSQIVGHVFSHEK**************************VRIAKTAITLCALFVASWTPYAVVALTGAFGD*
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGRMSYSKALMILILIYCYVIPWAMFPYLEKWSRFVPEGYLTSCTFDYLTPTESIRFYVLFMFIICYCIPMGMIINFYSQIVGHVFSHEKALREQAKKMNVESLRSGQKEGQSSAEVRIAKTAITLCALFVASWTPYAVVALTGAFGDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Opsin Rh3 Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.confidentP04950
Opsin Rh3 Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.confidentP28680
Opsin, ultraviolet-sensitive Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to 11-cis-retinal.confidentO61303

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008020 [MF]G-protein coupled photoreceptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0009881
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016056 [BP]rhodopsin mediated signaling pathwayprobableGO:0071482, GO:0009314, GO:0009416, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0071478, GO:0008150, GO:0065007, GO:0071214, GO:0007186, GO:0009581, GO:0009582, GO:0009583, GO:0009584, GO:0009628, GO:0009987, GO:0007603, GO:0007602, GO:0044763, GO:0007154, GO:0050794, GO:0044700, GO:0051606, GO:0009605, GO:0050896, GO:0023052
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:very confident
Coverage over the Query: 4-148
View the alignment between query and template
View the model in PyMOL