Diaphorina citri psyllid: psy15248

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MENADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKAQRLSANIIIIIIVLIYTARLGLKSPFTPAVGYYY
ccccccccccccccccHHHHHHHHHHHcccccccHHEEHHHHHHHHHHHHEEEHHHHcccccccccccccccccc
*************RWKLVYLTLLLHGVGTLMPWNMFITAKAQRLSANIIIIIIVLIYTARLGLKSPFTPAVGYYY
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKAQRLSANIIIIIIVLIYTARLGLKSPFTPAVGYYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Equilibrative nucleoside transporter 1 Mediates both influx and efflux of nucleosides across the membrane (equilibrative transporter). It is sensitive (ES) to low concentrations of the inhibitor nitrobenzylmercaptopurine riboside (NBMPR) and is sodium-independent. It has a higher affinity for adenosine. Resistant to dipyridamole and dilazep inhibition (anticancer chemotherapeutics drugs).confidentO54698

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007610 [BP]behaviorprobableGO:0050896, GO:0008150
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035364 [BP]thymine transportprobableGO:0015855, GO:0015851, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015853 [BP]adenine transportprobableGO:0015851, GO:0006810, GO:0006863, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0048609 [BP]multicellular organismal reproductive processprobableGO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0015862 [BP]uridine transportprobableGO:0015931, GO:0015864, GO:0006810, GO:0015858, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:1901264
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted