Psyllid ID: psy15248
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 347970858 | 495 | AGAP003892-PA [Anopheles gambiae str. PE | 0.546 | 0.082 | 0.731 | 5e-11 | |
| 242022750 | 450 | equilibrative nucleoside transporter, pu | 0.546 | 0.091 | 0.731 | 7e-11 | |
| 328716955 | 424 | PREDICTED: equilibrative nucleoside tran | 0.546 | 0.096 | 0.682 | 1e-10 | |
| 157109882 | 447 | equilibrative nucleoside transporter [Ae | 0.626 | 0.105 | 0.647 | 1e-10 | |
| 193702331 | 508 | PREDICTED: equilibrative nucleoside tran | 0.546 | 0.080 | 0.682 | 1e-10 | |
| 332025959 | 482 | Equilibrative nucleoside transporter 3 [ | 0.6 | 0.093 | 0.666 | 2e-10 | |
| 307200108 | 485 | Equilibrative nucleoside transporter 1 [ | 0.6 | 0.092 | 0.666 | 2e-10 | |
| 322785361 | 451 | hypothetical protein SINV_13768 [Solenop | 0.533 | 0.088 | 0.7 | 6e-10 | |
| 350413447 | 504 | PREDICTED: equilibrative nucleoside tran | 0.533 | 0.079 | 0.65 | 3e-09 | |
| 340717360 | 504 | PREDICTED: equilibrative nucleoside tran | 0.533 | 0.079 | 0.65 | 3e-09 |
| >gi|347970858|ref|XP_308120.4| AGAP003892-PA [Anopheles gambiae str. PEST] gi|333466405|gb|EAA03890.5| AGAP003892-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 72.0 bits (175), Expect = 5e-11, Method: Compositional matrix adjust.
Identities = 30/41 (73%), Positives = 37/41 (90%)
Query: 1 MENADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKA 41
ME A +E NPPRD+ +LV+LTL++HGVGTLMPWNMFITAK+
Sbjct: 70 MERAKMELNPPRDKLRLVFLTLMIHGVGTLMPWNMFITAKS 110
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242022750|ref|XP_002431801.1| equilibrative nucleoside transporter, putative [Pediculus humanus corporis] gi|212517133|gb|EEB19063.1| equilibrative nucleoside transporter, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328716955|ref|XP_003246084.1| PREDICTED: equilibrative nucleoside transporter 1-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|157109882|ref|XP_001650865.1| equilibrative nucleoside transporter [Aedes aegypti] gi|108878902|gb|EAT43127.1| AAEL005411-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|193702331|ref|XP_001948592.1| PREDICTED: equilibrative nucleoside transporter 1-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332025959|gb|EGI66115.1| Equilibrative nucleoside transporter 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307200108|gb|EFN80440.1| Equilibrative nucleoside transporter 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322785361|gb|EFZ12035.1| hypothetical protein SINV_13768 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|350413447|ref|XP_003489994.1| PREDICTED: equilibrative nucleoside transporter 1-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340717360|ref|XP_003397152.1| PREDICTED: equilibrative nucleoside transporter 1-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| FB|FBgn0263916 | 458 | Ent2 "Equilibrative nucleoside | 0.506 | 0.082 | 0.605 | 3.6e-07 | |
| WB|WBGene00010701 | 450 | ent-2 [Caenorhabditis elegans | 0.506 | 0.084 | 0.55 | 2.6e-06 | |
| WB|WBGene00001320 | 445 | ent-1 [Caenorhabditis elegans | 0.426 | 0.071 | 0.593 | 1.4e-05 | |
| WB|WBGene00009686 | 461 | ent-4 [Caenorhabditis elegans | 0.426 | 0.069 | 0.593 | 1.5e-05 | |
| RGD|69296 | 456 | Slc29a2 "solute carrier family | 0.413 | 0.067 | 0.548 | 4.2e-05 | |
| UNIPROTKB|Q99808 | 456 | SLC29A1 "Equilibrative nucleos | 0.706 | 0.116 | 0.388 | 0.00011 | |
| UNIPROTKB|B3KQV7 | 535 | SLC29A1 "cDNA FLJ33172 fis, cl | 0.706 | 0.099 | 0.388 | 0.00014 | |
| RGD|61899 | 457 | Slc29a1 "solute carrier family | 0.426 | 0.070 | 0.531 | 0.00018 | |
| UNIPROTKB|F1RQU4 | 482 | SLC29A1 "Uncharacterized prote | 0.533 | 0.082 | 0.476 | 0.00019 | |
| ZFIN|ZDB-GENE-050913-138 | 440 | slc29a1 "solute carrier family | 0.413 | 0.070 | 0.516 | 0.00022 |
| FB|FBgn0263916 Ent2 "Equilibrative nucleoside transporter 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 125 (49.1 bits), Expect = 3.6e-07, P = 3.6e-07
Identities = 23/38 (60%), Positives = 29/38 (76%)
Query: 4 ADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKA 41
A L P+D++ +V+ LLHGVGTLMPWNMFITAK+
Sbjct: 44 AKLGLPAPKDKFLIVFFIFLLHGVGTLMPWNMFITAKS 81
|
|
| WB|WBGene00010701 ent-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001320 ent-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009686 ent-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|69296 Slc29a2 "solute carrier family 29 (nucleoside transporters), member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99808 SLC29A1 "Equilibrative nucleoside transporter 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KQV7 SLC29A1 "cDNA FLJ33172 fis, clone ADRGL2002029, highly similar to Equilibrative nucleoside transporter 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|61899 Slc29a1 "solute carrier family 29 (nucleoside transporters), member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQU4 SLC29A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-138 slc29a1 "solute carrier family 29 (nucleoside transporters), member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| KOG1479|consensus | 406 | 99.49 | ||
| TIGR00939 | 437 | 2a57 Equilibrative Nucleoside Transporter (ENT). | 98.5 |
| >KOG1479|consensus | Back alignment and domain information |
|---|
Probab=99.49 E-value=1.7e-14 Score=113.59 Aligned_cols=64 Identities=39% Similarity=0.704 Sum_probs=52.8
Q ss_pred CCccCCCCCCCCcccchhhhHHHHHhhhcccchhhhhhhhhhh-----------------hhhHHHHHHHHHHHhhhccc
Q psy15248 1 MENADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKAQR-----------------LSANIIIIIIVLIYTARLGL 63 (75)
Q Consensus 1 ~~~~~~~~~~P~Dr~~~vyiif~llGiG~LlPWN~FITA~dY~-----------------~~~~~~~i~i~~~~~~r~~l 63 (75)
+|+++.+..+|+|+++.+|++|+++|+|+|+|||+||||.||| +..+.+..+++...+++++.
T Consensus 2 ~~~~~~~~~~p~d~~~~v~~i~~llGiG~LlpWN~fiTa~~y~~~~~~~~~~~~~F~~~~~~~a~i~~ll~~~~n~~~~~ 81 (406)
T KOG1479|consen 2 QDEVELDSPEPEDGYNLVYLIFLLLGIGTLLPWNMFITASDYYYYRFPGYHNSKNFTSSYTLAAQIPLLLFNLLNAFLNT 81 (406)
T ss_pred CccccccCCCcccccccHHHHHHHHhcccccchHhhhccHHHHHhhcCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4678899999999999999999999999999999999999973 44455555666677776655
Q ss_pred c
Q psy15248 64 K 64 (75)
Q Consensus 64 ~ 64 (75)
+
T Consensus 82 ~ 82 (406)
T KOG1479|consen 82 R 82 (406)
T ss_pred H
Confidence 4
|
|
| >TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00