Diaphorina citri psyllid: psy15257


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
ccccccccccEEEEEEEEcccccccEEEEHHHHHcccccccccccccccEEEEEEEEEccccccc
**********ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho-related BTB domain-containing protein 2 confidentQ91V93
Rho-related BTB domain-containing protein 2 confidentQ9BYZ6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035011 [BP]melanotic encapsulation of foreign targetprobableGO:0035006, GO:1901360, GO:0044710, GO:0042440, GO:0071704, GO:0006582, GO:0045087, GO:0019748, GO:0006725, GO:0006952, GO:0035010, GO:0006950, GO:0008150, GO:0008152, GO:0006955, GO:0018958, GO:0050896, GO:0044237, GO:0002376, GO:0002252, GO:0009987, GO:1901615
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ATX, chain A
Confidence level:very confident
Coverage over the Query: 7-58
View the alignment between query and template
View the model in PyMOL