Psyllid ID: psy15257


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
ccccccccccEEEEEEEEcccccccEEEEHHHHHcccccccccccccccEEEEEEEEEccccccc
cccccccccEEEEEEEEEEcccccHHHHHHHHHHcccccHHHHHHccccEEEEEHHHHHHHHHcc
mlsdneqphqELVKCVVVGDTAVGKTRLICARACNKQVSLSQLltthvptvwaidqYRIYKDTLE
mlsdneqphqelvKCVVVGDTAVGKTRLICARAcnkqvslsqlltthvptvwaidqyRIYKDTLE
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
***********LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK****
**********ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK****
*********QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
******QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query65 2.2.26 [Sep-21-2011]
Q9BYZ6 727 Rho-related BTB domain-co yes N/A 0.953 0.085 0.693 3e-20
Q91V93 728 Rho-related BTB domain-co yes N/A 0.953 0.085 0.693 3e-20
Q9DAK3 695 Rho-related BTB domain-co no N/A 0.953 0.089 0.693 5e-20
O94844 696 Rho-related BTB domain-co no N/A 0.953 0.089 0.693 3e-19
>sp|Q9BYZ6|RHBT2_HUMAN Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct: 6  DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query: 64 LE 65
          LE
Sbjct: 66 LE 67





Homo sapiens (taxid: 9606)
>sp|Q91V93|RHBT2_MOUSE Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2 Back     alignment and function description
>sp|Q9DAK3|RHBT1_MOUSE Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2 Back     alignment and function description
>sp|O94844|RHBT1_HUMAN Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
242004060 760 rhogtpase, putative [Pediculus humanus c 1.0 0.085 0.938 1e-28
332025461 732 Rho-related BTB domain-containing protei 0.953 0.084 0.967 5e-28
322801852 724 hypothetical protein SINV_08249 [Solenop 0.953 0.085 0.967 5e-28
156546178 748 PREDICTED: rho-related BTB domain-contai 0.953 0.082 0.967 5e-28
307205748 733 Rho-related BTB domain-containing protei 0.953 0.084 0.967 5e-28
383866215 738 PREDICTED: rho-related BTB domain-contai 0.953 0.084 0.967 6e-28
380024475 729 PREDICTED: rho-related BTB domain-contai 0.953 0.085 0.967 6e-28
328779913 737 PREDICTED: rho-related BTB domain-contai 0.953 0.084 0.967 6e-28
350397011 729 PREDICTED: rho-related BTB domain-contai 0.953 0.085 0.967 6e-28
350397014 737 PREDICTED: rho-related BTB domain-contai 0.953 0.084 0.967 7e-28
>gi|242004060|ref|XP_002422957.1| rhogtpase, putative [Pediculus humanus corporis] gi|212505873|gb|EEB10219.1| rhogtpase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/65 (93%), Positives = 62/65 (95%)

Query: 1  MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
          M+ DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIY
Sbjct: 1  MIMDNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIY 60

Query: 61 KDTLE 65
          KD LE
Sbjct: 61 KDVLE 65




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332025461|gb|EGI65626.1| Rho-related BTB domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322801852|gb|EFZ22424.1| hypothetical protein SINV_08249 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|156546178|ref|XP_001603776.1| PREDICTED: rho-related BTB domain-containing protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307205748|gb|EFN83978.1| Rho-related BTB domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383866215|ref|XP_003708566.1| PREDICTED: rho-related BTB domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024475|ref|XP_003696021.1| PREDICTED: rho-related BTB domain-containing protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|328779913|ref|XP_396485.3| PREDICTED: rho-related BTB domain-containing protein 2 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350397011|ref|XP_003484739.1| PREDICTED: rho-related BTB domain-containing protein 2-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350397014|ref|XP_003484740.1| PREDICTED: rho-related BTB domain-containing protein 2-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
FB|FBgn0036980 745 RhoBTB "Rho-related BTB domain 0.953 0.083 0.935 1e-26
UNIPROTKB|E5RI44182 RHOBTB2 "Rho-related BTB domai 0.953 0.340 0.693 1.9e-19
UNIPROTKB|F1RFZ1161 RHOBTB1 "Uncharacterized prote 0.953 0.385 0.693 1.9e-19
UNIPROTKB|F1NRT8 361 RHOBTB2 "Uncharacterized prote 0.953 0.171 0.693 2.6e-19
ZFIN|ZDB-GENE-081105-67 551 si:dkey-263f15.2 "si:dkey-263f 0.953 0.112 0.693 1.4e-18
ZFIN|ZDB-GENE-060315-11 716 rhobtb2a "Rho-related BTB doma 0.969 0.087 0.682 1.8e-18
UNIPROTKB|F1MZJ4 657 Bt.89377 "Uncharacterized prot 0.953 0.094 0.693 2e-18
UNIPROTKB|E1C5K2 666 RHOBTB1 "Uncharacterized prote 0.953 0.093 0.693 2e-18
MGI|MGI:1916538 695 Rhobtb1 "Rho-related BTB domai 0.953 0.089 0.693 2.2e-18
UNIPROTKB|O94844 696 RHOBTB1 "Rho-related BTB domai 0.953 0.089 0.693 2.2e-18
FB|FBgn0036980 RhoBTB "Rho-related BTB domain containing" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 1.0e-26, P = 1.0e-26
 Identities = 58/62 (93%), Positives = 60/62 (96%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             DNEQPHQELVKCV+VGDTAVGKTRLICARACNK VSLSQLL+THVPTVWAIDQYRIYKD 
Sbjct:     5 DNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDV 64

Query:    64 LE 65
             LE
Sbjct:    65 LE 66




GO:0003924 "GTPase activity" evidence=ISS;NAS
GO:0005525 "GTP binding" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0035011 "melanotic encapsulation of foreign target" evidence=IMP
UNIPROTKB|E5RI44 RHOBTB2 "Rho-related BTB domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFZ1 RHOBTB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRT8 RHOBTB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081105-67 si:dkey-263f15.2 "si:dkey-263f15.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060315-11 rhobtb2a "Rho-related BTB domain containing 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZJ4 Bt.89377 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5K2 RHOBTB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1916538 Rhobtb1 "Rho-related BTB domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O94844 RHOBTB1 "Rho-related BTB domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91V93RHBT2_MOUSENo assigned EC number0.69350.95380.0851yesN/A
Q9BYZ6RHBT2_HUMANNo assigned EC number0.69350.95380.0852yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
cd01873 195 cd01873, RhoBTB, RhoBTB protein is an atypical mem 5e-30
cd00157 171 cd00157, Rho, Ras homology family (Rho) of small g 6e-09
cd01874 175 cd01874, Cdc42, cell division cycle 42 (Cdc42) is 2e-04
cd04130 173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 5e-04
cd04133 173 cd04133, Rop_like, Rho-related protein from plants 0.001
cd00154 159 cd00154, Rab, Ras-related in brain (Rab) family of 0.003
cd01871 174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 0.003
>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases Back     alignment and domain information
 Score =  103 bits (258), Expect = 5e-30
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE 65
          E +KCVVVGD AVGKTRLICARACNK ++  QLL THVPTVWAIDQYR+ ++ LE
Sbjct: 1  ETIKCVVVGDNAVGKTRLICARACNKTLTQYQLLATHVPTVWAIDQYRVCQEVLE 55


Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium. RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function. RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades. RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors. Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs. Thus, the Dictyostelium RacA is not included here. Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature. Length = 195

>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
KOG0084|consensus 205 99.6
KOG0094|consensus 221 99.5
KOG0078|consensus 207 99.47
KOG0394|consensus 210 99.37
KOG0080|consensus 209 99.37
KOG0098|consensus 216 99.34
KOG0087|consensus 222 99.31
KOG0092|consensus 200 99.28
KOG0393|consensus 198 99.28
cd04172 182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.28
cd01875 191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.27
cd01874 175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.26
cd01873 195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.25
KOG0079|consensus 198 99.23
cd04131 178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.23
cd04174 232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.23
cd04133 176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.19
cd04128 182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.19
KOG0095|consensus 213 99.18
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.18
PLN03110 216 Rab GTPase; Provisional 99.16
PLN03071 219 GTP-binding nuclear protein Ran; Provisional 99.14
cd01892 169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.14
cd04121 189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.12
cd04141 172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.09
KOG0086|consensus 214 99.09
cd04120 202 Rab12 Rab12 subfamily. Rab12 was first identified 99.09
cd04108 170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.08
cd01871 174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.08
cd04138 162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.08
cd04109 215 Rab28 Rab28 subfamily. First identified in maize, 99.07
cd04127 180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.07
cd04107 201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.06
KOG0093|consensus 193 99.06
KOG0091|consensus 213 99.05
PF00071 162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.05
cd04136 163 Rap_like Rap-like subfamily. The Rap subfamily con 99.05
cd04102 202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.05
cd04117 161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.04
PLN00023 334 GTP-binding protein; Provisional 99.04
cd04111 211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.03
cd00877 166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.03
cd04110 199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.02
PTZ00369 189 Ras-like protein; Provisional 99.01
cd04119 168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.01
cd04122 166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.01
cd04134 189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.0
cd04176 163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.0
KOG0395|consensus 196 99.0
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 99.0
cd01867 167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.98
cd04175 164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.98
cd04130 173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.97
cd01865 165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.97
cd01870 175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.96
KOG0081|consensus 219 98.96
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 98.95
cd04103 158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.95
cd04135 174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.95
cd04101 164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.95
cd04116 170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.94
cd01864 165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.94
cd04140 165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.93
cd04115 170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.93
cd01869 166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.92
cd04106 162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.92
smart00173 164 RAS Ras subfamily of RAS small GTPases. Similar in 98.92
cd04132 187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.91
cd04125 188 RabA_like RabA-like subfamily. RabA was first iden 98.91
cd04142 198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.9
COG1100 219 GTPase SAR1 and related small G proteins [General 98.89
PLN03108 210 Rab family protein; Provisional 98.89
cd04145 164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.87
cd04124 161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.87
KOG0088|consensus 218 98.87
cd01866 168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.87
cd01868 165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.86
cd04144 190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.86
KOG0097|consensus 215 98.85
cd04177 168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.84
cd04113 161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.83
cd04118 193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.83
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.82
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.81
smart00174 174 RHO Rho (Ras homology) subfamily of Ras-like small 98.81
cd04150 159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.79
cd04162 164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.77
cd01862 172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.77
cd01860 163 Rab5_related Rab5-related subfamily. This subfamil 98.77
PTZ00133 182 ADP-ribosylation factor; Provisional 98.77
cd04146 165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.76
cd04112 191 Rab26 Rab26 subfamily. First identified in rat pan 98.76
smart00177 175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.76
cd04139 164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.75
KOG4252|consensus 246 98.74
cd04129 187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.74
cd00157 171 Rho Rho (Ras homology) family. Members of the Rho 98.74
cd04114 169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.73
cd01861 161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.73
PLN03118 211 Rab family protein; Provisional 98.73
smart00175 164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.72
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.71
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.71
cd04147 198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.71
cd04149 168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.7
PLN00223 181 ADP-ribosylation factor; Provisional 98.68
cd04137 180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.65
cd00154 159 Rab Rab family. Rab GTPases form the largest famil 98.63
cd04158 169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.63
cd04152 183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.62
cd01863 161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.62
cd04159 159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.61
cd01893 166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.61
cd04157 162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.58
smart00176 200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.57
cd00876 160 Ras Ras family. The Ras family of the Ras superfam 98.56
cd04123 162 Rab21 Rab21 subfamily. The localization and functi 98.55
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.51
cd04154 173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.5
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.49
cd04161 167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.48
TIGR00231 161 small_GTP small GTP-binding protein domain. This m 98.48
cd04151 158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.46
smart00178 184 SAR Sar1p-like members of the Ras-family of small 98.43
PRK04213 201 GTP-binding protein; Provisional 98.39
cd04160 167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.38
cd04156 160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.38
PRK00454 196 engB GTP-binding protein YsxC; Reviewed 98.36
cd04153 174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.34
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.33
KOG0096|consensus 216 98.31
cd00878 158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.3
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 98.22
TIGR03598 179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.21
cd04105 203 SR_beta Signal recognition particle receptor, beta 98.19
KOG0083|consensus 192 98.14
PF00025 175 Arf: ADP-ribosylation factor family The prints ent 98.13
cd01897 168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.11
KOG1673|consensus 205 98.08
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.08
cd01876 170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.03
cd01898 170 Obg Obg subfamily. The Obg nucleotide binding prot 98.02
KOG4423|consensus 229 97.96
COG1419 407 FlhF Flagellar GTP-binding protein [Cell motility 97.94
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.88
cd01896 233 DRG The developmentally regulated GTP-binding prot 97.85
KOG1707|consensus 625 97.82
cd04171 164 SelB SelB subfamily. SelB is an elongation factor 97.81
cd01891 194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.8
cd04164 157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.76
cd01887 168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 97.72
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 97.71
TIGR03156 351 GTP_HflX GTP-binding protein HflX. This protein fa 97.69
PRK15494 339 era GTPase Era; Provisional 97.69
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.67
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.66
cd01881 176 Obg_like The Obg-like subfamily consists of five w 97.65
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 97.64
PRK11058 426 GTPase HflX; Provisional 97.61
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.6
cd04163 168 Era Era subfamily. Era (E. coli Ras-like protein) 97.59
cd01879 158 FeoB Ferrous iron transport protein B (FeoB) subfa 97.56
KOG3883|consensus 198 97.52
cd01895 174 EngA2 EngA2 subfamily. This CD represents the seco 97.48
TIGR02729 329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.47
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.46
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.43
cd01889 192 SelB_euk SelB subfamily. SelB is an elongation fac 97.42
PF02421 156 FeoB_N: Ferrous iron transport protein B; InterPro 97.41
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.4
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.4
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.39
PRK08118 167 topology modulation protein; Reviewed 97.38
cd01894 157 EngA1 EngA1 subfamily. This CD represents the firs 97.36
PRK09602 396 translation-associated GTPase; Reviewed 97.34
cd00882 157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.33
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.33
cd04165 224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 97.33
PRK00093 435 GTP-binding protein Der; Reviewed 97.31
PRK07261 171 topology modulation protein; Provisional 97.3
PRK03003 472 GTP-binding protein Der; Reviewed 97.3
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 97.26
cd00881 189 GTP_translation_factor GTP translation factor fami 97.26
PF09439 181 SRPRB: Signal recognition particle receptor beta s 97.25
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 97.25
COG0563 178 Adk Adenylate kinase and related kinases [Nucleoti 97.24
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 97.23
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.22
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 97.2
cd01890 179 LepA LepA subfamily. LepA belongs to the GTPase fa 97.2
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.19
PF04548 212 AIG1: AIG1 family; InterPro: IPR006703 This entry 97.19
smart00382148 AAA ATPases associated with a variety of cellular 97.19
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.16
PRK15467 158 ethanolamine utilization protein EutP; Provisional 97.15
PRK12296 500 obgE GTPase CgtA; Reviewed 97.15
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.13
KOG0070|consensus 181 97.13
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 97.12
PRK14738 206 gmk guanylate kinase; Provisional 97.12
COG4525 259 TauB ABC-type taurine transport system, ATPase com 97.12
cd01852 196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.12
cd03238 176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.11
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.1
PF00004132 AAA: ATPase family associated with various cellula 97.08
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.07
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.06
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.06
PRK03003 472 GTP-binding protein Der; Reviewed 97.06
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.06
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 97.05
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 97.05
PRK14737 186 gmk guanylate kinase; Provisional 97.05
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.05
TIGR02322 179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.03
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and met 97.02
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.01
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.0
KOG0073|consensus 185 96.99
TIGR03263 180 guanyl_kin guanylate kinase. Members of this famil 96.98
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.97
PF13521 163 AAA_28: AAA domain; PDB: 1LW7_A. 96.96
PRK12297 424 obgE GTPase CgtA; Reviewed 96.95
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.95
PF1355562 AAA_29: P-loop containing region of AAA domain 96.95
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.95
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.95
PRK06217 183 hypothetical protein; Validated 96.94
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 96.93
PF05729 166 NACHT: NACHT domain 96.92
PRK00089 292 era GTPase Era; Reviewed 96.91
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.89
COG1162301 Predicted GTPases [General function prediction onl 96.88
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 96.86
PRK00300 205 gmk guanylate kinase; Provisional 96.85
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.84
PRK12288347 GTPase RsgA; Reviewed 96.82
PF13173128 AAA_14: AAA domain 96.81
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.79
COG3638 258 ABC-type phosphate/phosphonate transport system, A 96.78
PF03266 168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.78
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.77
PRK05541 176 adenylylsulfate kinase; Provisional 96.77
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.77
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.76
PRK12299 335 obgE GTPase CgtA; Reviewed 96.76
PRK05480 209 uridine/cytidine kinase; Provisional 96.75
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 96.75
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 96.74
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 96.73
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 96.72
PHA00729 226 NTP-binding motif containing protein 96.72
TIGR01313 163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.71
PF00625 183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.71
smart00072 184 GuKc Guanylate kinase homologues. Active enzymes c 96.7
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.7
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.7
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.7
PRK10416 318 signal recognition particle-docking protein FtsY; 96.69
PF07724 171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 96.69
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 96.68
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.68
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.67
cd04167 213 Snu114p Snu114p subfamily. Snu114p is one of sever 96.67
TIGR00101 199 ureG urease accessory protein UreG. This model rep 96.66
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.66
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.66
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 96.65
cd03269 210 ABC_putative_ATPase This subfamily is involved in 96.65
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.65
TIGR00235 207 udk uridine kinase. Model contains a number of lon 96.64
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.63
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.63
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 96.63
PRK13695 174 putative NTPase; Provisional 96.63
PRK12289 352 GTPase RsgA; Reviewed 96.63
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.62
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 96.62
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 96.61
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.61
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.6
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.6
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.6
PRK06893 229 DNA replication initiation factor; Validated 96.58
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.58
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.58
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 96.58
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 96.57
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.57
PRK09563 287 rbgA GTPase YlqF; Reviewed 96.57
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 96.57
PRK05057 172 aroK shikimate kinase I; Reviewed 96.55
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.55
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 96.55
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.55
PRK03839 180 putative kinase; Provisional 96.55
PF13479 213 AAA_24: AAA domain 96.54
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.54
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 96.54
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.53
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 96.53
PRK09183 259 transposase/IS protein; Provisional 96.52
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 96.52
PRK14530 215 adenylate kinase; Provisional 96.51
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.51
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 96.51
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.51
TIGR00064 272 ftsY signal recognition particle-docking protein F 96.5
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.5
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 96.5
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 96.5
PRK08084 235 DNA replication initiation factor; Provisional 96.49
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.49
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 96.49
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 96.48
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.46
PRK00098298 GTPase RsgA; Reviewed 96.46
PRK13949 169 shikimate kinase; Provisional 96.46
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 96.45
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 96.45
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.45
PRK14532 188 adenylate kinase; Provisional 96.45
PRK06526 254 transposase; Provisional 96.45
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 96.45
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 96.44
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.44
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 96.44
PRK10908 222 cell division protein FtsE; Provisional 96.44
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 96.44
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 96.43
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 96.43
PRK09087 226 hypothetical protein; Validated 96.42
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.42
COG0218 200 Predicted GTPase [General function prediction only 96.42
PRK08181 269 transposase; Validated 96.41
cd03214 180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.41
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.41
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 96.41
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.41
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 96.4
PRK08903 227 DnaA regulatory inactivator Hda; Validated 96.4
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 96.4
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 96.4
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.39
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 96.38
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 96.38
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 96.38
cd01120 165 RecA-like_NTPases RecA-like NTPases. This family i 96.38
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 96.38
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 96.38
PRK02496 184 adk adenylate kinase; Provisional 96.38
PRK08233 182 hypothetical protein; Provisional 96.38
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 96.37
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 96.37
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 96.37
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 96.37
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 96.37
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.37
PRK08727 233 hypothetical protein; Validated 96.36
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 96.36
COG4161 242 ArtP ABC-type arginine transport system, ATPase co 96.36
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 96.36
PRK05642 234 DNA replication initiation factor; Validated 96.35
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 96.35
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 96.35
PRK00093 435 GTP-binding protein Der; Reviewed 96.35
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 96.35
COG1618 179 Predicted nucleotide kinase [Nucleotide transport 96.35
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 96.35
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 96.34
PRK14974 336 cell division protein FtsY; Provisional 96.34
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 96.34
PRK06620 214 hypothetical protein; Validated 96.34
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.34
PRK13851 344 type IV secretion system protein VirB11; Provision 96.34
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.33
COG0572 218 Udk Uridine kinase [Nucleotide transport and metab 96.33
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 96.32
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 96.32
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 96.32
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 96.32
cd03215 182 ABC_Carb_Monos_II This family represents domain II 96.32
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 96.32
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 96.31
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.31
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 96.31
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 96.31
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 96.3
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 96.3
COG4987 573 CydC ABC-type transport system involved in cytochr 96.3
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 96.3
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 96.29
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 96.29
PRK06547 172 hypothetical protein; Provisional 96.29
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 96.28
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.28
cd03246173 ABCC_Protease_Secretion This family represents the 96.28
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.28
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.28
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 96.28
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.27
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 96.27
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 96.27
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 96.27
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain 96.27
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 96.27
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 96.26
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.26
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 96.26
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 96.26
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 96.26
COG0552 340 FtsY Signal recognition particle GTPase [Intracell 96.26
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 96.26
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.25
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 96.25
PRK13947 171 shikimate kinase; Provisional 96.25
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 96.25
cd03234 226 ABCG_White The White subfamily represents ABC tran 96.25
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 96.24
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 96.24
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 96.24
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 96.24
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 96.24
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 96.24
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 96.24
cd03240 204 ABC_Rad50 The catalytic domains of Rad50 are simil 96.23
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 96.23
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 96.23
COG4619 223 ABC-type uncharacterized transport system, ATPase 96.22
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 96.22
PRK10751 173 molybdopterin-guanine dinucleotide biosynthesis pr 96.22
cd01128 249 rho_factor Transcription termination factor rho is 96.22
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 96.22
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.21
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 96.21
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 96.21
cd00880 163 Era_like Era (E. coli Ras-like protein)-like. This 96.21
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 96.21
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.2
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 96.2
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 96.2
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 96.2
PRK14531 183 adenylate kinase; Provisional 96.2
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 96.2
PLN02772 398 guanylate kinase 96.2
PRK12298 390 obgE GTPase CgtA; Reviewed 96.2
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 96.2
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 96.2
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 96.2
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 96.19
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.19
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 96.19
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 96.19
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.18
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 96.18
PTZ00088 229 adenylate kinase 1; Provisional 96.18
smart00053 240 DYNc Dynamin, GTPase. Large GTPases that mediate v 96.17
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.17
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 96.17
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 96.17
COG4136 213 ABC-type uncharacterized transport system, ATPase 96.17
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.16
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 96.16
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 96.15
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 96.15
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.15
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 96.15
PRK09825 176 idnK D-gluconate kinase; Provisional 96.15
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.15
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 96.14
cd00227 175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.14
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 96.14
KOG0060|consensus 659 96.13
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 96.13
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 96.13
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 96.13
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 96.13
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 96.13
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 96.13
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 96.12
PTZ00258 390 GTP-binding protein; Provisional 96.12
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 96.12
PRK00131 175 aroK shikimate kinase; Reviewed 96.11
cd03217 200 ABC_FeS_Assembly ABC-type transport system involve 96.11
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.11
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 96.11
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 96.1
PRK15064 530 ABC transporter ATP-binding protein; Provisional 96.1
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 96.1
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 96.1
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 96.1
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 96.1
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 96.1
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 96.09
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 96.09
PLN02165 334 adenylate isopentenyltransferase 96.09
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 96.08
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 96.08
PRK09984 262 phosphonate/organophosphate ester transporter subu 96.08
cd00464 154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.08
>KOG0084|consensus Back     alignment and domain information
Probab=99.60  E-value=2.3e-15  Score=90.99  Aligned_cols=50  Identities=22%  Similarity=0.275  Sum_probs=44.5

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      +...++.||++++||+|||||||+.|      |..+.|.+.|.+||| ||+-.++++
T Consensus         3 ~~~~dylFKiiliGds~VGKtCL~~R------f~~~~f~e~~~sTIG-VDf~~rt~e   52 (205)
T KOG0084|consen    3 NPEYDYLFKIILIGDSGVGKTCLLLR------FKDDTFTESYISTIG-VDFKIRTVE   52 (205)
T ss_pred             CcccceEEEEEEECCCCcChhhhhhh------hccCCcchhhcceee-eEEEEEEee
Confidence            45678999999999999999999998      999999999999999 887765554



>KOG0094|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
1doa_A 191 Structure Of The Rho Family Gtp-Binding Protein Cdc 5e-04
2dfk_B 194 Crystal Structure Of The Cdc42-Collybistin Ii Compl 6e-04
2wm9_B 190 Structure Of The Complex Between Dock9 And Cdc42. L 6e-04
>pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 Back     alignment and structure

Iteration: 1

Score = 39.3 bits (90), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 8/51 (15%) Query: 9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59 H + +KCVVVGD AVGKT L+ + NK + +VPTV+ D Y + Sbjct: 3 HMQTIKCVVVGDGAVGKTCLLISYTTNK------FPSEYVPTVF--DNYAV 45
>pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 Back     alignment and structure
>pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 9e-12
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 9e-12
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-11
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 2e-10
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 3e-10
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 8e-10
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 9e-10
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 3e-09
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 3e-09
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 5e-09
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 1e-08
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 6e-08
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 8e-08
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
 Score = 55.9 bits (135), Expect = 9e-12
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 1  MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
          M  +   P    VK V+VGD   GKT L+   A            ++ PTV+  ++Y + 
Sbjct: 23 MAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGA------FPESYTPTVF--ERYMVN 74


>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 99.39
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.08
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 99.0
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.99
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 98.99
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.99
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 98.98
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 98.98
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.98
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 98.97
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 98.96
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.96
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.95
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.95
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.95
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 98.93
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.93
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 98.93
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.92
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.91
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.91
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 98.91
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.9
2hxs_A 178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.9
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.89
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.89
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.89
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 98.89
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.89
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.89
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.89
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 98.89
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 98.88
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.88
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.88
1c1y_A 167 RAS-related protein RAP-1A; GTP-binding proteins, 98.88
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.88
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 98.87
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 98.87
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.87
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.86
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.86
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.86
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 98.86
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.86
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 98.85
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.84
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 98.84
1kao_A 167 RAP2A; GTP-binding protein, small G protein, GDP, 98.84
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.84
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 98.84
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.83
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 98.83
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.83
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 98.82
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 98.82
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.82
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 98.82
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.82
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.81
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 98.81
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.81
1ek0_A 170 Protein (GTP-binding protein YPT51); vesicular tra 98.81
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 98.81
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.79
2erx_A 172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.79
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 98.79
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.78
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.78
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.78
1g16_A 170 RAS-related protein SEC4; G protein RAB, signaling 98.78
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.77
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 98.77
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 98.75
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.74
2fh5_B 214 SR-beta, signal recognition particle receptor beta 98.73
2ce2_X 166 GTPase HRAS; signaling protein, guanine nucleotide 98.72
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.72
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 98.71
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 98.7
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.7
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.67
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.67
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 98.12
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.65
3q85_A 169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.63
2nzj_A 175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.62
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 98.6
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 98.6
1nrj_B 218 SR-beta, signal recognition particle receptor beta 98.6
1r8s_A 164 ADP-ribosylation factor 1; protein transport/excha 98.6
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.58
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.57
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.57
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 98.56
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 98.55
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.55
2wji_A 165 Ferrous iron transport protein B homolog; membrane 98.53
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 98.51
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.49
3q72_A 166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.48
2ged_A193 SR-beta, signal recognition particle receptor beta 98.47
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.47
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.46
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.46
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 98.45
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 98.45
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.42
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 98.38
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 98.36
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.35
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.35
2hf9_A 226 Probable hydrogenase nickel incorporation protein 98.33
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 98.33
3llu_A 196 RAS-related GTP-binding protein C; structural geno 98.32
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 98.28
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 98.26
2dyk_A 161 GTP-binding protein; GTPase, ribosome-binding prot 98.23
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 98.22
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 98.19
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 98.19
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 98.18
2gj8_A 172 MNME, tRNA modification GTPase TRME; G-domain dime 98.18
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 98.11
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 98.1
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 98.07
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 98.04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.04
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.95
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 97.92
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 97.88
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.87
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 97.79
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 97.66
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.63
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 97.61
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.61
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.61
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.58
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.57
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 97.57
1wxq_A 397 GTP-binding protein; structural genomics, riken st 97.55
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.54
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.52
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.51
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.5
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 97.49
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.47
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 97.46
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.45
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 97.42
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.4
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.39
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 97.38
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 97.37
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.37
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 97.36
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.36
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.36
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.32
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 97.3
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.3
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 97.26
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 97.24
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.23
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 97.22
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.22
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 97.21
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.2
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.19
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 97.16
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.15
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 97.15
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.08
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.04
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 97.04
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.02
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.01
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 97.0
1via_A 175 Shikimate kinase; structural genomics, transferase 96.99
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.98
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 96.98
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 96.97
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 96.97
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.95
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 96.94
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 96.93
3kb2_A 173 SPBC2 prophage-derived uncharacterized protein YOR 96.93
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 96.93
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.92
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.89
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 96.89
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 96.89
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 96.89
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.87
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 96.86
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.86
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.86
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.86
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.86
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 96.85
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 96.84
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.84
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.84
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 96.82
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.82
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.81
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 96.81
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.81
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 96.8
1g6h_A 257 High-affinity branched-chain amino acid transport 96.8
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.79
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.79
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 96.79
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.78
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 96.78
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.78
1ji0_A 240 ABC transporter; ATP binding protein, structural g 96.77
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.76
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.76
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.76
2eyu_A 261 Twitching motility protein PILT; pilus retraction 96.76
1sgw_A 214 Putative ABC transporter; structural genomics, P p 96.75
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.75
2ghi_A 260 Transport protein; multidrug resistance protein, M 96.75
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.74
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.74
4a74_A 231 DNA repair and recombination protein RADA; hydrola 96.73
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 96.73
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.73
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.73
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.72
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.72
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.69
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.69
3bos_A 242 Putative DNA replication factor; P-loop containing 96.68
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.67
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.67
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.66
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 96.66
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.66
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 96.65
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 96.65
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 96.65
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.65
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 96.64
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.64
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 96.64
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.64
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.64
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.62
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.62
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 96.62
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.62
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.61
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 96.61
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.6
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 96.59
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 96.59
2chg_A 226 Replication factor C small subunit; DNA-binding pr 96.58
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.58
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 96.58
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.58
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 96.57
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.57
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 96.56
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.56
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.56
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.56
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.55
3kta_A 182 Chromosome segregation protein SMC; structural mai 96.54
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.53
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.52
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.51
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.5
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.5
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.5
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 96.5
1wb1_A 482 Translation elongation factor SELB; selenocysteine 96.49
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 96.49
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 96.47
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.47
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 96.45
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.45
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 96.45
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.43
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 96.43
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.42
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.41
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.41
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.41
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.4
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.4
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.38
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.38
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.37
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.37
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.37
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 96.36
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.36
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 96.36
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 96.34
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 96.33
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 96.33
2og2_A 359 Putative signal recognition particle receptor; nuc 96.31
2f1r_A 171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.31
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.31
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.3
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.3
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.29
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 96.29
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.29
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.29
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.28
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.28
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.28
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.28
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.27
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.27
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 96.25
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.25
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.25
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 96.25
2ewv_A 372 Twitching motility protein PILT; pilus retraction 96.24
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.24
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.24
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.23
2cvh_A 220 DNA repair and recombination protein RADB; filamen 96.22
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.21
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.18
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.17
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.17
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 96.16
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 96.15
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 96.15
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.15
2fna_A 357 Conserved hypothetical protein; structural genomic 96.14
2qgz_A 308 Helicase loader, putative primosome component; str 96.14
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.13
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.13
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.13
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.12
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.11
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.11
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.09
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.09
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.08
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.08
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.08
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.07
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.07
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 96.07
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.07
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.06
2pt5_A 168 Shikimate kinase, SK; aromatic amino acid biosynth 96.06
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 96.06
3co5_A143 Putative two-component system transcriptional RES 96.06
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.06
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.05
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.05
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.04
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.04
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.04
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.03
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.03
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.02
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.02
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 96.02
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.02
2xtz_A 354 Guanine nucleotide-binding protein alpha-1 subuni; 96.01
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.0
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.0
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.99
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.99
1xjc_A 169 MOBB protein homolog; structural genomics, midwest 95.98
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.98
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 95.96
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.95
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.94
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 95.94
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.94
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 95.93
1e6c_A 173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.92
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.92
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 95.92
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 95.91
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.91
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 95.91
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.9
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 95.9
1p9r_A 418 General secretion pathway protein E; bacterial typ 95.9
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 95.89
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.89
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 95.89
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.88
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 95.88
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 95.88
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.88
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.87
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 95.86
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.86
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.86
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.85
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.85
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.85
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 95.83
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.83
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 95.83
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.82
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 95.82
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.81
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 95.81
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 95.81
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 95.8
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 95.79
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 95.78
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 95.78
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 95.77
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.76
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.76
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 95.76
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 95.74
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.73
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 95.73
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 95.73
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 95.72
3ohm_A 327 Guanine nucleotide-binding protein G(Q) subunit A; 95.72
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.71
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.71
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.68
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.68
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 95.67
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.65
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 95.64
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.64
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 95.62
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.62
2vli_A 183 Antibiotic resistance protein; transferase, tunica 95.62
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 95.6
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.59
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 95.58
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.58
4fid_A 340 G protein alpha subunit; RAS-like domain, all-heli 95.56
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.55
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 95.55
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.55
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 95.54
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.49
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.47
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 95.47
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 95.47
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 95.46
3pvs_A 447 Replication-associated recombination protein A; ma 95.44
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 95.44
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.43
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.43
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 95.43
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 95.42
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.39
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 95.39
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.38
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 95.37
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.33
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.31
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.3
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 95.28
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.27
1e69_A 322 Chromosome segregation SMC protein; structural mai 95.26
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 95.26
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 95.25
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.24
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 95.24
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 95.22
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 95.22
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.21
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.21
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 95.21
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.18
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 95.18
2chq_A 319 Replication factor C small subunit; DNA-binding pr 95.17
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.17
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 95.17
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.16
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 95.15
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.15
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 95.14
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 95.12
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 95.11
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 95.08
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 95.07
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.02
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.02
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.0
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 95.0
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.0
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.92
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.88
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 94.88
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.88
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.84
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.39  E-value=2.9e-13  Score=81.35  Aligned_cols=45  Identities=29%  Similarity=0.268  Sum_probs=28.7

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +...|||+++|++|||||||+.|      |..+.|...|.||++ +|++.+.
T Consensus        10 P~k~~KivlvGd~~VGKTsLi~r------~~~~~f~~~~~~Tig-~d~~~k~   54 (216)
T 4dkx_A           10 PLRKFKLVFLGEQSVGKTSLITR------FMYDSFDNTYQATIG-IDFLSKT   54 (216)
T ss_dssp             ---CEEEEEECSTTSSHHHHHHH------HHHSCCC-----------CEEEE
T ss_pred             CCCcEEEEEECcCCcCHHHHHHH------HHhCCCCCCcCCccc-eEEEEEE
Confidence            34569999999999999999998      999999999999998 6766544



>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 65
d2atxa1 185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 9e-06
d2fn4a1 173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 2e-04
d2ngra_ 191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 2e-04
d1wmsa_ 174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 3e-04
d1kmqa_ 177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 4e-04
d2f9la1 175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 4e-04
d1vg8a_ 184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 4e-04
d2atva1 168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 5e-04
d1mh1a_ 183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 7e-04
d2f7sa1 186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 8e-04
d1zj6a1 177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 0.001
d2ew1a1 171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 0.001
d1m7ba_ 179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 0.001
d1yzqa1 164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 0.001
d1z0fa1 166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 0.001
d1g16a_ 166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 0.002
d2a5ja1 173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 0.002
d2g6ba1 170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 0.002
d1ky3a_ 175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 0.002
d2erya1 171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 0.002
d1z08a1 167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 0.002
d2g3ya1 172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 0.002
d1u8za_ 168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 0.002
d1ek0a_ 170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 0.002
d1kaoa_ 167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 0.002
d1ctqa_ 166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.002
d2bcgy1 194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 0.003
d1z06a1 165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 0.003
d3raba_ 169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 0.003
d1z2aa1 164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 0.003
d1z0ja1 167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 0.003
d2fu5c1 173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 0.004
d2qtvb1 166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 0.004
d1c1ya_ 167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 0.004
d2bmea1 174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 0.004
d1r2qa_ 170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 0.004
d2bmja1 175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 0.004
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoQ
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.4 bits (88), Expect = 9e-06
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 8  PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          P   ++KCVVVGD AVGKT L+     N       + T       ++   
Sbjct: 5  PGALMLKCVVVGDGAVGKTCLLM-SYANDAFPEEYVPTVFDHYAVSVTVG 53


>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2atva1 168 Ras-like estrogen-regulated growth inhibitor, RERG 99.28
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.28
d2erxa1 171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.25
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1i2ma_ 170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.23
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.22
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.21
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.18
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.15
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1ek0a_ 170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.13
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.12
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1yzqa1 164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.08
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1g16a_ 166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.06
d2a5ja1 173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d2f9la1 175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.04
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.0
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1ky3a_ 175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.95
d2gjsa1 168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.91
d2g3ya1 172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.87
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.86
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.76
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.67
d1r8sa_ 160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.65
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.64
d2qtvb1 166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.6
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.59
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.57
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.53
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.43
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.39
d2fh5b1 207 Signal recognition particle receptor beta-subunit 98.19
d2gj8a1 161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.99
d1vmaa2 213 GTPase domain of the signal recognition particle r 97.94
d1wf3a1 178 GTPase Era, N-terminal domain {Thermus thermophilu 97.92
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.91
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 97.9
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.89
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 97.87
d1xzpa2 160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.77
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.75
d1j8yf2 211 GTPase domain of the signal sequence recognition p 97.64
d1okkd2 207 GTPase domain of the signal recognition particle r 97.62
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 97.61
d1ls1a2 207 GTPase domain of the signal sequence recognition p 97.61
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 97.6
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 97.6
d2qy9a2 211 GTPase domain of the signal recognition particle r 97.59
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.57
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.56
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.54
d1mkya1 171 Probable GTPase Der, N-terminal and middle domains 97.52
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.43
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.43
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.38
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 97.36
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.33
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.31
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.31
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.3
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.27
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.25
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.22
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.2
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.18
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 97.15
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.13
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.1
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.09
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.08
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.08
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.06
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.05
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.05
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.05
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.04
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.03
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.02
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 96.99
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.98
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.98
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.96
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 96.96
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.96
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.96
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.95
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 96.91
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.91
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 96.91
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.9
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.9
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 96.9
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.9
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.89
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.88
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.85
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 96.84
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.84
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.83
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.83
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 96.82
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 96.81
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.81
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.8
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 96.79
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.78
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.78
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 96.77
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.76
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.75
d1e6ca_ 170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.75
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 96.72
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.72
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.69
d1g2912 240 Maltose transport protein MalK, N-terminal domain 96.67
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.66
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.64
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.62
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.62
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.61
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.57
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.55
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 96.53
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.51
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 96.47
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.46
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 96.46
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 96.43
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.37
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.36
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.34
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 96.34
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.33
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.32
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.3
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 96.26
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.24
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 96.22
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 96.21
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.21
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.14
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.13
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 96.1
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 96.09
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.09
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 96.08
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.04
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.04
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 96.03
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.03
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.03
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.99
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.95
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 95.94
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.9
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.85
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.85
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.7
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.7
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.63
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 95.57
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.55
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.53
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.5
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.46
d1ko7a2 169 HPr kinase HprK C-terminal domain {Staphylococcus 95.46
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.28
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.25
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.16
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 95.02
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 95.0
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.96
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.91
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 94.86
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.85
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.78
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.66
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.63
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 94.56
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 94.53
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 94.53
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 94.47
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 94.44
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.4
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 94.34
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 94.33
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.33
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.27
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.19
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 94.12
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.06
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.04
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.04
d1xpua3 289 Transcription termination factor Rho, ATPase domai 93.97
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 93.88
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 93.76
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.6
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 93.55
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.48
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.34
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.24
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 92.89
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 92.53
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 92.39
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.39
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 92.28
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.23
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.12
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.02
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 92.0
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.93
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.59
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 91.2
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 91.16
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 91.08
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.93
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 90.79
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.77
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 90.38
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.19
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.14
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 89.39
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 89.07
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.96
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 88.7
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 88.48
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 88.3
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 88.11
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 87.88
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 87.14
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 86.89
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 86.4
d1gm5a3 264 RecG helicase domain {Thermotoga maritima [TaxId: 86.15
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.85
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 85.6
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 85.46
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.33
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 84.54
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 83.9
d1c9ka_ 180 Adenosylcobinamide kinase/adenosylcobinamide phosp 83.81
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.74
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 83.69
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.47
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 82.46
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 82.11
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.92
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 80.73
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 80.46
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap1A
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.33  E-value=7.7e-13  Score=74.42  Aligned_cols=44  Identities=30%  Similarity=0.371  Sum_probs=38.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      +.|||+++|++|||||||+.|      |..+.|...|.||++  +.+...+.
T Consensus         2 r~~KivvvG~~~vGKTsli~r------~~~~~f~~~~~~t~~--~~~~~~~~   45 (167)
T d1c1ya_           2 REYKLVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYRKQVE   45 (167)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH------HHHCCCCCSCCCCSE--EEEEEEEE
T ss_pred             ceeEEEEECCCCCCHHHHHHH------HHcCCCCCccCCccc--cccceeEE
Confidence            468999999999999999998      888999999999999  77766554



>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure