Psyllid ID: psy15257

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60-----
Protein Sequence
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
Secondary Structure (PSIPRED)
ccccccccccEEEEEEEEcccccccEEEEHHHHHcccccccccccccccEEEEEEEEEccccccc
Secondary Structure Prediction (SSPRO)
cccccccccEEEEEEEEEEcccccHHHHHHHHHHcccccHHHHHHccccEEEEEHHHHHHHHHcc
Coil and Loop (DISEMBL)
mlsdneqphqELVKCVVVGDTAVGKTRLICARACNKQVSLSQLltthvptvwaidqYRIYKDTLE
Flexible Loop (DISEMBL)
mlsdneqphqelvKCVVVGDTAVGKTRLICARAcnkqvslsqlltthvptvwaidqyRIYKDTLE
Low Complexity Region (SEG)
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
Disordered region (IsUnstruct)
***********LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK****
Disordered Region (DISOPRED)
**********ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK****
Disordered Region (DISEMBL)
*********QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
Disordered Region (DISPRO)
******QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
Transmembrane Helix (TMHMM)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (Phobius)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	65	2.2.26 [Sep-21-2011]
Q9BYZ6	727	Rho-related BTB domain-co	yes	N/A	0.953	0.085	0.693	3e-20
Q91V93	728	Rho-related BTB domain-co	yes	N/A	0.953	0.085	0.693	3e-20
Q9DAK3	695	Rho-related BTB domain-co	no	N/A	0.953	0.089	0.693	5e-20
O94844	696	Rho-related BTB domain-co	no	N/A	0.953	0.089	0.693	3e-19

>sp|Q9BYZ6|RHBT2_HUMAN Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct: 6  DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query: 64 LE 65
          LE
Sbjct: 66 LE 67

Homo sapiens (taxid: 9606)

>sp|Q91V93|RHBT2_MOUSE Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct: 6  DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query: 64 LE 65
          LE
Sbjct: 66 LE 67

Mus musculus (taxid: 10090)

>sp|Q9DAK3|RHBT1_MOUSE Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct: 6  DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query: 64 LE 65
          LE
Sbjct: 66 LE 67

Mus musculus (taxid: 10090)

>sp|O94844|RHBT1_HUMAN Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=1 SV=2

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct: 6  DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query: 64 LE 65
          LE
Sbjct: 66 LE 67

Homo sapiens (taxid: 9606)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	65
242004060	760	rhogtpase, putative [Pediculus humanus c	1.0	0.085	0.938	1e-28
332025461	732	Rho-related BTB domain-containing protei	0.953	0.084	0.967	5e-28
322801852	724	hypothetical protein SINV_08249 [Solenop	0.953	0.085	0.967	5e-28
156546178	748	PREDICTED: rho-related BTB domain-contai	0.953	0.082	0.967	5e-28
307205748	733	Rho-related BTB domain-containing protei	0.953	0.084	0.967	5e-28
383866215	738	PREDICTED: rho-related BTB domain-contai	0.953	0.084	0.967	6e-28
380024475	729	PREDICTED: rho-related BTB domain-contai	0.953	0.085	0.967	6e-28
328779913	737	PREDICTED: rho-related BTB domain-contai	0.953	0.084	0.967	6e-28
350397011	729	PREDICTED: rho-related BTB domain-contai	0.953	0.085	0.967	6e-28
350397014	737	PREDICTED: rho-related BTB domain-contai	0.953	0.084	0.967	7e-28

>gi|242004060|ref|XP_002422957.1| rhogtpase, putative [Pediculus humanus corporis] gi|212505873|gb|EEB10219.1| rhogtpase, putative [Pediculus humanus corporis]

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/65 (93%), Positives = 62/65 (95%)

Query: 1  MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
          M+ DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIY
Sbjct: 1  MIMDNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIY 60

Query: 61 KDTLE 65
          KD LE
Sbjct: 61 KDVLE 65

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332025461|gb|EGI65626.1| Rho-related BTB domain-containing protein 2 [Acromyrmex echinatior]

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322801852|gb|EFZ22424.1| hypothetical protein SINV_08249 [Solenopsis invicta]

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156546178|ref|XP_001603776.1| PREDICTED: rho-related BTB domain-containing protein 1-like [Nasonia vitripennis]

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307205748|gb|EFN83978.1| Rho-related BTB domain-containing protein 1 [Harpegnathos saltator]

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383866215|ref|XP_003708566.1| PREDICTED: rho-related BTB domain-containing protein 1-like [Megachile rotundata]

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380024475|ref|XP_003696021.1| PREDICTED: rho-related BTB domain-containing protein 2-like [Apis florea]

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328779913|ref|XP_396485.3| PREDICTED: rho-related BTB domain-containing protein 2 isoform 1 [Apis mellifera]

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350397011|ref|XP_003484739.1| PREDICTED: rho-related BTB domain-containing protein 2-like isoform 1 [Bombus impatiens]

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350397014|ref|XP_003484740.1| PREDICTED: rho-related BTB domain-containing protein 2-like isoform 2 [Bombus impatiens]

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 60/62 (96%)

Query: 4  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          DNEQPHQELVKCVVVGDTAVGKTRLICARACNK VSLSQLLTTHVPTVWAIDQYRIYKD 
Sbjct: 2  DNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKDV 61

Query: 64 LE 65
          LE
Sbjct: 62 LE 63

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	65
FB|FBgn0036980	745	RhoBTB "Rho-related BTB domain	0.953	0.083	0.935	1e-26
UNIPROTKB|E5RI44	182	RHOBTB2 "Rho-related BTB domai	0.953	0.340	0.693	1.9e-19
UNIPROTKB|F1RFZ1	161	RHOBTB1 "Uncharacterized prote	0.953	0.385	0.693	1.9e-19
UNIPROTKB|F1NRT8	361	RHOBTB2 "Uncharacterized prote	0.953	0.171	0.693	2.6e-19
ZFIN|ZDB-GENE-081105-67	551	si:dkey-263f15.2 "si:dkey-263f	0.953	0.112	0.693	1.4e-18
ZFIN|ZDB-GENE-060315-11	716	rhobtb2a "Rho-related BTB doma	0.969	0.087	0.682	1.8e-18
UNIPROTKB|F1MZJ4	657	Bt.89377 "Uncharacterized prot	0.953	0.094	0.693	2e-18
UNIPROTKB|E1C5K2	666	RHOBTB1 "Uncharacterized prote	0.953	0.093	0.693	2e-18
MGI|MGI:1916538	695	Rhobtb1 "Rho-related BTB domai	0.953	0.089	0.693	2.2e-18
UNIPROTKB|O94844	696	RHOBTB1 "Rho-related BTB domai	0.953	0.089	0.693	2.2e-18

FB|FBgn0036980 RhoBTB "Rho-related BTB domain containing" [Drosophila melanogaster (taxid:7227)]

 Score = 310 (114.2 bits), Expect = 1.0e-26, P = 1.0e-26
 Identities = 58/62 (93%), Positives = 60/62 (96%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             DNEQPHQELVKCV+VGDTAVGKTRLICARACNK VSLSQLL+THVPTVWAIDQYRIYKD 
Sbjct:     5 DNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDV 64

Query:    64 LE 65
             LE
Sbjct:    65 LE 66

GO:0003924 "GTPase activity" evidence=ISS;NAS

GO:0005525 "GTP binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0035011 "melanotic encapsulation of foreign target" evidence=IMP

UNIPROTKB|E5RI44 RHOBTB2 "Rho-related BTB domain-containing protein 2" [Homo sapiens (taxid:9606)]

 Score = 232 (86.7 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:    28 DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 87

Query:    64 LE 65
             LE
Sbjct:    88 LE 89

GO:0005622 "intracellular" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0016020 "membrane" evidence=IEA

UNIPROTKB|F1RFZ1 RHOBTB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]

 Score = 232 (86.7 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0016020 "membrane" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

UNIPROTKB|F1NRT8 RHOBTB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 232 (86.7 bits), Expect = 2.6e-19, P = 2.6e-19
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0005622 "intracellular" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

ZFIN|ZDB-GENE-081105-67 si:dkey-263f15.2 "si:dkey-263f15.2" [Danio rerio (taxid:7955)]

 Score = 232 (86.7 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:    30 DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 89

Query:    64 LE 65
             LE
Sbjct:    90 LE 91

GO:0005622 "intracellular" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

ZFIN|ZDB-GENE-060315-11 rhobtb2a "Rho-related BTB domain containing 2a" [Danio rerio (taxid:7955)]

 Score = 233 (87.1 bits), Expect = 1.8e-18, P = 1.8e-18
 Identities = 43/63 (68%), Positives = 52/63 (82%)

Query:     3 SDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD 62
             +D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++
Sbjct:     5 TDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQE 64

Query:    63 TLE 65
              LE
Sbjct:    65 VLE 67

GO:0005525 "GTP binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

UNIPROTKB|F1MZJ4 Bt.89377 "Uncharacterized protein" [Bos taurus (taxid:9913)]

 Score = 232 (86.7 bits), Expect = 2.0e-18, P = 2.0e-18
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0005525 "GTP binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

UNIPROTKB|E1C5K2 RHOBTB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 232 (86.7 bits), Expect = 2.0e-18, P = 2.0e-18
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0005622 "intracellular" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

MGI|MGI:1916538 Rhobtb1 "Rho-related BTB domain containing 1" [Mus musculus (taxid:10090)]

 Score = 232 (86.7 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0005575 "cellular_component" evidence=ND

GO:0005622 "intracellular" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

UNIPROTKB|O94844 RHOBTB1 "Rho-related BTB domain-containing protein 1" [Homo sapiens (taxid:9606)]

 Score = 232 (86.7 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query:     4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
             D E+P+ E +KCVVVGD AVGKTRLICARACN  ++  QLL THVPTVWAIDQYR+ ++ 
Sbjct:     6 DYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEV 65

Query:    64 LE 65
             LE
Sbjct:    66 LE 67

GO:0005525 "GTP binding" evidence=IEA

GO:0005829 "cytosol" evidence=TAS

GO:0005886 "plasma membrane" evidence=TAS

GO:0007264 "small GTPase mediated signal transduction" evidence=TAS

GO:0051056 "regulation of small GTPase mediated signal transduction" evidence=TAS

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q91V93	RHBT2_MOUSE	No assigned EC number	0.6935	0.9538	0.0851	yes	N/A
Q9BYZ6	RHBT2_HUMAN	No assigned EC number	0.6935	0.9538	0.0852	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Length	Definition	E-value
Query	65
cd01873	195	cd01873, RhoBTB, RhoBTB protein is an atypical mem	5e-30
cd00157	171	cd00157, Rho, Ras homology family (Rho) of small g	6e-09
cd01874	175	cd01874, Cdc42, cell division cycle 42 (Cdc42) is	2e-04
cd04130	173	cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W	5e-04
cd04133	173	cd04133, Rop_like, Rho-related protein from plants	0.001
cd00154	159	cd00154, Rab, Ras-related in brain (Rab) family of	0.003
cd01871	174	cd01871, Rac1_like, Ras-related C3 botulinum toxin	0.003

>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases

 Score =  103 bits (258), Expect = 5e-30
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE 65
          E +KCVVVGD AVGKTRLICARACNK ++  QLL THVPTVWAIDQYR+ ++ LE
Sbjct: 1  ETIKCVVVGDNAVGKTRLICARACNKTLTQYQLLATHVPTVWAIDQYRVCQEVLE 55

Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium. RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function. RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades. RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors. Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs. Thus, the Dictyostelium RacA is not included here. Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature. Length = 195

>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases)

 Score = 48.7 bits (117), Expect = 6e-09
 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 8/45 (17%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          +K VVVGD AVGKT L+ +   NK        T +VPTV+  D Y
Sbjct: 1  IKIVVVGDGAVGKTCLLISYTTNK------FPTEYVPTVF--DNY 37

Members of the Rho (Ras homology) family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop. There are 22 human Rho family members identified currently. These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli. They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase. These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Since crystal structures often lack C-terminal residues, this feature is not available for annotation in many of the CDs in the hierarchy. Length = 171

>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family

 Score = 36.4 bits (84), Expect = 2e-04
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 8/47 (17%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59
          +KCVVVGD AVGKT L+ +   NK  S       +VPTV+  D Y +
Sbjct: 2  IKCVVVGDGAVGKTCLLISYTTNKFPS------EYVPTVF--DNYAV 40

Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases. These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway. Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth. In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus. Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand. In addition, Cdc42 has been implicated in a number of human diseases through interactions with its regulators and downstream effectors. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 175

>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42

 Score = 35.5 bits (82), Expect = 5e-04
 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 8/45 (17%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          +KCV+VGD AVGKT LI +   N         T +VPT  A D +
Sbjct: 1  LKCVLVGDGAVGKTSLIVSYTTNG------YPTEYVPT--AFDNF 37

Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 173

>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like

 Score = 34.1 bits (78), Expect = 0.001
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW 52
          +KCV VGD AVGKT   C        +     T +VPTV+
Sbjct: 2  IKCVTVGDGAVGKT---CMLISYTSNTFP---TDYVPTVF 35

The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance. Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade. They transmit a variety of extracellular and intracellular signals. Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility. An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins. For example, Rop1, Rop3, and Rop5 are all involved in pollen-tube growth; Rop2 plays a role in response to low-oxygen environments, cell-morphology, and root-hair development; root-hair development is also regulated by Rop4 and Rop6; Rop6 is also responsible for ABA response, and ABA response is also regulated by Rop10. Plants retain some of the regulatory mechanisms that are shared by other members of the Rho family, but have also developed a number of unique modes for regulating Rops. Unique RhoGEFs have been identified that are exclusively active toward Rop proteins, such as those containing the domain PRONE (plant-specific Rop nucleotide exchanger). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 173

>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases)

 Score = 33.2 bits (77), Expect = 0.003
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHV 48
           K V++GD+ VGKT L+  R  + + S +   T  V
Sbjct: 1  FKIVLIGDSGVGKTSLLL-RFVDNKFSENYKSTIGV 35

Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which mask C-terminal lipid binding and promote cytosolic localization. While most unicellular organisms possess 5-20 Rab members, several have been found to possess 60 or more Rabs; for many of these Rab isoforms, homologous proteins are not found in other organisms. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Since crystal structures often lack C-terminal residues, the lipid modification site is not available for annotation in many of the CDs in the hierarchy, but is included where possible. Length = 159

>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3

 Score = 33.2 bits (76), Expect = 0.003
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 13 VKCVVVGDTAVGKTRLICARACN 35
          +KCVVVGD AVGKT L+ +   N
Sbjct: 2  IKCVVVGDGAVGKTCLLISYTTN 24

The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1. While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively. Rac1 stimulates the formation of actin lamellipodia and membrane ruffles. It also plays a role in cell-matrix adhesion and cell anoikis. In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis. Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation. In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis. Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleotide association and is more efficiently activated by the RacGEF Tiam1. Both Rac1 and Rac3 have been implicated in the regulation of cell migration and invasion in human metastatic breast cancer. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 174

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	65
KOG0084|consensus	205		99.6
KOG0094|consensus	221		99.5
KOG0078|consensus	207		99.47
KOG0394|consensus	210		99.37
KOG0080|consensus	209		99.37
KOG0098|consensus	216		99.34
KOG0087|consensus	222		99.31
KOG0092|consensus	200		99.28
KOG0393|consensus	198		99.28
cd04172	182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.28
cd01875	191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.27
cd01874	175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.26
cd01873	195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.25
KOG0079|consensus	198		99.23
cd04131	178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.23
cd04174	232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.23
cd04133	176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.19
cd04128	182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.19
KOG0095|consensus	213		99.18
cd04173	222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.18
PLN03110	216	Rab GTPase; Provisional	99.16
PLN03071	219	GTP-binding nuclear protein Ran; Provisional	99.14
cd01892	169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.14
cd04121	189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.12
cd04141	172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.09
KOG0086|consensus	214		99.09
cd04120	202	Rab12 Rab12 subfamily. Rab12 was first identified	99.09
cd04108	170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.08
cd01871	174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.08
cd04138	162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.08
cd04109	215	Rab28 Rab28 subfamily. First identified in maize,	99.07
cd04127	180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.07
cd04107	201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.06
KOG0093|consensus	193		99.06
KOG0091|consensus	213		99.05
PF00071	162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.05
cd04136	163	Rap_like Rap-like subfamily. The Rap subfamily con	99.05
cd04102	202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.05
cd04117	161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.04
PLN00023	334	GTP-binding protein; Provisional	99.04
cd04111	211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.03
cd00877	166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.03
cd04110	199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.02
PTZ00369	189	Ras-like protein; Provisional	99.01
cd04119	168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.01
cd04122	166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.01
cd04134	189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.0
cd04176	163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.0
KOG0395|consensus	196		99.0
PTZ00132	215	GTP-binding nuclear protein Ran; Provisional	99.0
cd01867	167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	98.98
cd04175	164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	98.98
cd04130	173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.97
cd01865	165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	98.97
cd01870	175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.96
KOG0081|consensus	219		98.96
cd04143	247	Rhes_like Rhes_like subfamily. This subfamily incl	98.95
cd04103	158	Centaurin_gamma Centaurin gamma. The centaurins (a	98.95
cd04135	174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.95
cd04101	164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	98.95
cd04116	170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.94
cd01864	165	Rab19 Rab19 subfamily. Rab19 proteins are associat	98.94
cd04140	165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	98.93
cd04115	170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.93
cd01869	166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	98.92
cd04106	162	Rab23_lke Rab23-like subfamily. Rab23 is a member	98.92
smart00173	164	RAS Ras subfamily of RAS small GTPases. Similar in	98.92
cd04132	187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.91
cd04125	188	RabA_like RabA-like subfamily. RabA was first iden	98.91
cd04142	198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	98.9
COG1100	219	GTPase SAR1 and related small G proteins [General	98.89
PLN03108	210	Rab family protein; Provisional	98.89
cd04145	164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	98.87
cd04124	161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	98.87
KOG0088|consensus	218		98.87
cd01866	168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	98.87
cd01868	165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	98.86
cd04144	190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	98.86
KOG0097|consensus	215		98.85
cd04177	168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.84
cd04113	161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	98.83
cd04118	193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	98.83
cd04126	220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	98.82
cd04148	221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.81
smart00174	174	RHO Rho (Ras homology) subfamily of Ras-like small	98.81
cd04150	159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	98.79
cd04162	164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	98.77
cd01862	172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.77
cd01860	163	Rab5_related Rab5-related subfamily. This subfamil	98.77
PTZ00133	182	ADP-ribosylation factor; Provisional	98.77
cd04146	165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.76
cd04112	191	Rab26 Rab26 subfamily. First identified in rat pan	98.76
smart00177	175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	98.76
cd04139	164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.75
KOG4252|consensus	246		98.74
cd04129	187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	98.74
cd00157	171	Rho Rho (Ras homology) family. Members of the Rho	98.74
cd04114	169	Rab30 Rab30 subfamily. Rab30 appears to be associa	98.73
cd01861	161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	98.73
PLN03118	211	Rab family protein; Provisional	98.73
smart00175	164	RAB Rab subfamily of small GTPases. Rab GTPases ar	98.72
TIGR02528	142	EutP ethanolamine utilization protein, EutP. This	98.71
smart00010	124	small_GTPase Small GTPase of the Ras superfamily;	98.71
cd04147	198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.71
cd04149	168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	98.7
PLN00223	181	ADP-ribosylation factor; Provisional	98.68
cd04137	180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.65
cd00154	159	Rab Rab family. Rab GTPases form the largest famil	98.63
cd04158	169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	98.63
cd04152	183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	98.62
cd01863	161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	98.62
cd04159	159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	98.61
cd01893	166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.61
cd04157	162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	98.58
smart00176	200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	98.57
cd00876	160	Ras Ras family. The Ras family of the Ras superfam	98.56
cd04123	162	Rab21 Rab21 subfamily. The localization and functi	98.55
PF08477	119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	98.51
cd04154	173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	98.5
cd04155	173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	98.49
cd04161	167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	98.48
TIGR00231	161	small_GTP small GTP-binding protein domain. This m	98.48
cd04151	158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	98.46
smart00178	184	SAR Sar1p-like members of the Ras-family of small	98.43
PRK04213	201	GTP-binding protein; Provisional	98.39
cd04160	167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	98.38
cd04156	160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	98.38
PRK00454	196	engB GTP-binding protein YsxC; Reviewed	98.36
cd04153	174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	98.34
cd00879	190	Sar1 Sar1 subfamily. Sar1 is an essential componen	98.33
KOG0096|consensus	216		98.31
cd00878	158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	98.3
cd01878	204	HflX HflX subfamily. A distinct conserved domain w	98.22
TIGR03598	179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.21
cd04105	203	SR_beta Signal recognition particle receptor, beta	98.19
KOG0083|consensus	192		98.14
PF00025	175	Arf: ADP-ribosylation factor family The prints ent	98.13
cd01897	168	NOG NOG1 is a nucleolar GTP-binding protein presen	98.11
KOG1673|consensus	205		98.08
cd01850	276	CDC_Septin CDC/Septin. Septins are a conserved fam	98.08
cd01876	170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.03
cd01898	170	Obg Obg subfamily. The Obg nucleotide binding prot	98.02
KOG4423|consensus	229		97.96
COG1419	407	FlhF Flagellar GTP-binding protein [Cell motility	97.94
cd04104	197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	97.88
cd01896	233	DRG The developmentally regulated GTP-binding prot	97.85
KOG1707|consensus	625		97.82
cd04171	164	SelB SelB subfamily. SelB is an elongation factor	97.81
cd01891	194	TypA_BipA TypA (tyrosine phosphorylated protein A)	97.8
cd04164	157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	97.76
cd01887	168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	97.72
TIGR00450	442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	97.71
TIGR03156	351	GTP_HflX GTP-binding protein HflX. This protein fa	97.69
PRK15494	339	era GTPase Era; Provisional	97.69
PF00448	196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.67
TIGR00991	313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	97.66
cd01881	176	Obg_like The Obg-like subfamily consists of five w	97.65
cd01853	249	Toc34_like Toc34-like (Translocon at the Outer-env	97.64
PRK11058	426	GTPase HflX; Provisional	97.61
PF10662	143	PduV-EutP: Ethanolamine utilisation - propanediol	97.6
cd04163	168	Era Era subfamily. Era (E. coli Ras-like protein)	97.59
cd01879	158	FeoB Ferrous iron transport protein B (FeoB) subfa	97.56
KOG3883|consensus	198		97.52
cd01895	174	EngA2 EngA2 subfamily. This CD represents the seco	97.48
TIGR02729	329	Obg_CgtA Obg family GTPase CgtA. This model descri	97.47
PF03193	161	DUF258: Protein of unknown function, DUF258; Inter	97.46
COG3839	338	MalK ABC-type sugar transport systems, ATPase comp	97.43
cd01889	192	SelB_euk SelB subfamily. SelB is an elongation fac	97.42
PF02421	156	FeoB_N: Ferrous iron transport protein B; InterPro	97.41
PF01926	116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	97.4
cd01899	318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	97.4
COG1116	248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	97.39
PRK08118	167	topology modulation protein; Reviewed	97.38
cd01894	157	EngA1 EngA1 subfamily. This CD represents the firs	97.36
PRK09602	396	translation-associated GTPase; Reviewed	97.34
cd00882	157	Ras_like_GTPase Ras-like GTPase superfamily. The R	97.33
PF13207	121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.33
cd04165	224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	97.33
PRK00093	435	GTP-binding protein Der; Reviewed	97.31
PRK07261	171	topology modulation protein; Provisional	97.3
PRK03003	472	GTP-binding protein Der; Reviewed	97.3
TIGR00436	270	era GTP-binding protein Era. Era is an essential G	97.26
cd00881	189	GTP_translation_factor GTP translation factor fami	97.26
PF09439	181	SRPRB: Signal recognition particle receptor beta s	97.25
PRK05291	449	trmE tRNA modification GTPase TrmE; Reviewed	97.25
COG0563	178	Adk Adenylate kinase and related kinases [Nucleoti	97.24
PF00735	281	Septin: Septin; InterPro: IPR000038 Septins consti	97.23
cd01856	171	YlqF YlqF. Proteins of the YlqF family contain all	97.22
PRK10078	186	ribose 1,5-bisphosphokinase; Provisional	97.2
cd01890	179	LepA LepA subfamily. LepA belongs to the GTPase fa	97.2
COG3842	352	PotA ABC-type spermidine/putrescine transport syst	97.19
PF04548	212	AIG1: AIG1 family; InterPro: IPR006703 This entry	97.19
smart00382	148	AAA ATPases associated with a variety of cellular	97.19
cd01857	141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	97.16
PRK15467	158	ethanolamine utilization protein EutP; Provisional	97.15
PRK12296	500	obgE GTPase CgtA; Reviewed	97.15
TIGR03594	429	GTPase_EngA ribosome-associated GTPase EngA. EngA	97.13
KOG0070|consensus	181		97.13
COG1126	240	GlnQ ABC-type polar amino acid transport system, A	97.12
PRK14738	206	gmk guanylate kinase; Provisional	97.12
COG4525	259	TauB ABC-type taurine transport system, ATPase com	97.12
cd01852	196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	97.12
cd03238	176	ABC_UvrA The excision repair protein UvrA; Nucleot	97.11
PRK09518	712	bifunctional cytidylate kinase/GTPase Der; Reviewe	97.1
PF00004	132	AAA: ATPase family associated with various cellula	97.08
PF07728	139	AAA_5: AAA domain (dynein-related subfamily); Inte	97.07
PF13671	143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	97.06
cd00071	137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	97.06
PRK03003	472	GTP-binding protein Der; Reviewed	97.06
cd01859	156	MJ1464 MJ1464. This family represents archaeal GTP	97.06
COG1136	226	SalX ABC-type antimicrobial peptide transport syst	97.05
PRK09554	772	feoB ferrous iron transport protein B; Reviewed	97.05
PRK14737	186	gmk guanylate kinase; Provisional	97.05
PF13191	185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.05
TIGR02322	179	phosphon_PhnN phosphonate metabolism protein/1,5-b	97.03
COG0194	191	Gmk Guanylate kinase [Nucleotide transport and met	97.02
cd00820	107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	97.01
cd00009	151	AAA The AAA+ (ATPases Associated with a wide varie	97.0
KOG0073|consensus	185		96.99
TIGR03263	180	guanyl_kin guanylate kinase. Members of this famil	96.98
TIGR03594	429	GTPase_EngA ribosome-associated GTPase EngA. EngA	96.97
PF13521	163	AAA_28: AAA domain; PDB: 1LW7_A.	96.96
PRK12297	424	obgE GTPase CgtA; Reviewed	96.95
TIGR03499	282	FlhF flagellar biosynthetic protein FlhF.	96.95
PF13555	62	AAA_29: P-loop containing region of AAA domain	96.95
PF00005	137	ABC_tran: ABC transporter This structure is on hol	96.95
PF13401	131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.95
PRK06217	183	hypothetical protein; Validated	96.94
PRK11889	436	flhF flagellar biosynthesis regulator FlhF; Provis	96.93
PF05729	166	NACHT: NACHT domain	96.92
PRK00089	292	era GTPase Era; Reviewed	96.91
PF04665	241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	96.89
COG1162	301	Predicted GTPases [General function prediction onl	96.88
COG1117	253	PstB ABC-type phosphate transport system, ATPase c	96.86
PRK00300	205	gmk guanylate kinase; Provisional	96.85
cd01858	157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	96.84
PRK12288	347	GTPase RsgA; Reviewed	96.82
PF13173	128	AAA_14: AAA domain	96.81
COG1120	258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	96.79
COG3638	258	ABC-type phosphate/phosphonate transport system, A	96.78
PF03266	168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	96.78
PF01637	234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	96.77
PRK05541	176	adenylylsulfate kinase; Provisional	96.77
PRK12726	407	flagellar biosynthesis regulator FlhF; Provisional	96.77
cd03255	218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	96.76
PRK12299	335	obgE GTPase CgtA; Reviewed	96.76
PRK05480	209	uridine/cytidine kinase; Provisional	96.75
TIGR03596	276	GTPase_YlqF ribosome biogenesis GTP-binding protei	96.75
PF04670	232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	96.74
TIGR00487	587	IF-2 translation initiation factor IF-2. This mode	96.73
PRK12723	388	flagellar biosynthesis regulator FlhF; Provisional	96.72
PHA00729	226	NTP-binding motif containing protein	96.72
TIGR01313	163	therm_gnt_kin carbohydrate kinase, thermoresistant	96.71
PF00625	183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	96.71
smart00072	184	GuKc Guanylate kinase homologues. Active enzymes c	96.7
TIGR00960	216	3a0501s02 Type II (General) Secretory Pathway (IIS	96.7
TIGR00157	245	ribosome small subunit-dependent GTPase A. The Aqu	96.7
cd03226	205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	96.7
PRK10416	318	signal recognition particle-docking protein FtsY;	96.69
PF07724	171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	96.69
COG1125	309	OpuBA ABC-type proline/glycine betaine transport s	96.68
TIGR02315	243	ABC_phnC phosphonate ABC transporter, ATP-binding	96.68
PF13238	129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	96.67
cd04167	213	Snu114p Snu114p subfamily. Snu114p is one of sever	96.67
TIGR00101	199	ureG urease accessory protein UreG. This model rep	96.66
cd03225	211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	96.66
cd04178	172	Nucleostemin_like Nucleostemin-like. Nucleostemin	96.66
cd03264	211	ABC_drug_resistance_like ABC-type multidrug transp	96.65
cd03269	210	ABC_putative_ATPase This subfamily is involved in	96.65
TIGR03015	269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.65
TIGR00235	207	udk uridine kinase. Model contains a number of lon	96.64
cd03292	214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	96.63
cd03224	222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	96.63
PF12775	272	AAA_7: P-loop containing dynein motor region D3; P	96.63
PRK13695	174	putative NTPase; Provisional	96.63
PRK12289	352	GTPase RsgA; Reviewed	96.63
PRK14722	374	flhF flagellar biosynthesis regulator FlhF; Provis	96.62
cd03257	228	ABC_NikE_OppD_transporters The ABC transporter sub	96.62
TIGR01166	190	cbiO cobalt transport protein ATP-binding subunit.	96.61
cd03261	235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	96.61
TIGR03608	206	L_ocin_972_ABC putative bacteriocin export ABC tra	96.6
cd03262	213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	96.6
cd03222	177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	96.6
PRK06893	229	DNA replication initiation factor; Validated	96.58
cd03260	227	ABC_PstB_phosphate_transporter Phosphate uptake is	96.58
cd03259	213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	96.58
TIGR02673	214	FtsE cell division ATP-binding protein FtsE. This	96.58
cd03265	220	ABC_DrrA DrrA is the ATP-binding protein component	96.57
TIGR03420	226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	96.57
PRK09563	287	rbgA GTPase YlqF; Reviewed	96.57
cd03235	213	ABC_Metallic_Cations ABC component of the metal-ty	96.57
PRK05057	172	aroK shikimate kinase I; Reviewed	96.55
TIGR01360	188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	96.55
cd03266	218	ABC_NatA_sodium_exporter NatA is the ATPase compon	96.55
TIGR02211	221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	96.55
PRK03839	180	putative kinase; Provisional	96.55
PF13479	213	AAA_24: AAA domain	96.54
cd03293	220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	96.54
cd03219	236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	96.54
cd03256	241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	96.53
cd03218	232	ABC_YhbG The ABC transporters belonging to the Yhb	96.53
PRK09183	259	transposase/IS protein; Provisional	96.52
TIGR01978	243	sufC FeS assembly ATPase SufC. SufC is part of the	96.52
PRK14530	215	adenylate kinase; Provisional	96.51
PRK14721	420	flhF flagellar biosynthesis regulator FlhF; Provis	96.51
TIGR02868	529	CydC thiol reductant ABC exporter, CydC subunit. T	96.51
cd02023	198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	96.51
TIGR00064	272	ftsY signal recognition particle-docking protein F	96.5
cd03263	220	ABC_subfamily_A The ABCA subfamily mediates the tr	96.5
PRK15177	213	Vi polysaccharide export ATP-binding protein VexC;	96.5
PRK11629	233	lolD lipoprotein transporter ATP-binding subunit;	96.5
PRK08084	235	DNA replication initiation factor; Provisional	96.49
cd03301	213	ABC_MalK_N The N-terminal ATPase domain of the mal	96.49
PRK11248	255	tauB taurine transporter ATP-binding subunit; Prov	96.49
PRK11247	257	ssuB aliphatic sulfonates transport ATP-binding su	96.48
cd02019	69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.46
PRK00098	298	GTPase RsgA; Reviewed	96.46
PRK13949	169	shikimate kinase; Provisional	96.46
TIGR03410	230	urea_trans_UrtE urea ABC transporter, ATP-binding	96.45
cd03258	233	ABC_MetN_methionine_transporter MetN (also known a	96.45
cd03216	163	ABC_Carb_Monos_I This family represents the domain	96.45
PRK14532	188	adenylate kinase; Provisional	96.45
PRK06526	254	transposase; Provisional	96.45
cd03268	208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	96.45
TIGR02881	261	spore_V_K stage V sporulation protein K. Members o	96.44
cd01131	198	PilT Pilus retraction ATPase PilT. PilT is a nucle	96.44
PRK10895	241	lipopolysaccharide ABC transporter ATP-binding pro	96.44
PRK10908	222	cell division protein FtsE; Provisional	96.44
PRK12724	432	flagellar biosynthesis regulator FlhF; Provisional	96.44
PRK13540	200	cytochrome c biogenesis protein CcmA; Provisional	96.43
TIGR03864	236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	96.43
PRK09087	226	hypothetical protein; Validated	96.42
cd03233	202	ABC_PDR_domain1 The pleiotropic drug resistance (P	96.42
COG0218	200	Predicted GTPase [General function prediction only	96.42
PRK08181	269	transposase; Validated	96.41
cd03214	180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	96.41
cd03297	214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	96.41
cd03237	246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	96.41
cd03229	178	ABC_Class3 This class is comprised of all BPD (Bin	96.41
TIGR01189	198	ccmA heme ABC exporter, ATP-binding protein CcmA.	96.4
PRK08903	227	DnaA regulatory inactivator Hda; Validated	96.4
cd03296	239	ABC_CysA_sulfate_importer Part of the ABC transpor	96.4
cd03298	211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	96.4
cd03230	173	ABC_DR_subfamily_A This family of ATP-binding prot	96.39
PRK13638	271	cbiO cobalt transporter ATP-binding subunit; Provi	96.38
PRK14242	253	phosphate transporter ATP-binding protein; Provisi	96.38
PRK13541	195	cytochrome c biogenesis protein CcmA; Provisional	96.38
cd01120	165	RecA-like_NTPases RecA-like NTPases. This family i	96.38
cd03272	243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	96.38
PRK10584	228	putative ABC transporter ATP-binding protein YbbA;	96.38
PRK02496	184	adk adenylate kinase; Provisional	96.38
PRK08233	182	hypothetical protein; Provisional	96.38
PRK11124	242	artP arginine transporter ATP-binding subunit; Pro	96.37
PRK10247	225	putative ABC transporter ATP-binding protein YbbL;	96.37
TIGR02323	253	CP_lyasePhnK phosphonate C-P lyase system protein	96.37
cd03278	197	ABC_SMC_barmotin Barmotin is a tight junction-asso	96.37
cd03273	251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	96.37
cd03232	192	ABC_PDR_domain2 The pleiotropic drug resistance-li	96.37
PRK08727	233	hypothetical protein; Validated	96.36
PRK14247	250	phosphate ABC transporter ATP-binding protein; Pro	96.36
COG4161	242	ArtP ABC-type arginine transport system, ATPase co	96.36
cd01849	155	YlqF_related_GTPase YlqF-related GTPases. These pr	96.36
PRK05642	234	DNA replication initiation factor; Validated	96.35
PRK13538	204	cytochrome c biogenesis protein CcmA; Provisional	96.35
PRK13539	207	cytochrome c biogenesis protein CcmA; Provisional	96.35
PRK00093	435	GTP-binding protein Der; Reviewed	96.35
TIGR00475	581	selB selenocysteine-specific elongation factor Sel	96.35
COG1618	179	Predicted nucleotide kinase [Nucleotide transport	96.35
cd03254	229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	96.35
cd01130	186	VirB11-like_ATPase Type IV secretory pathway compo	96.34
PRK14974	336	cell division protein FtsY; Provisional	96.34
TIGR03238	504	dnd_assoc_3 dnd system-associated protein 3. cereu	96.34
PRK06620	214	hypothetical protein; Validated	96.34
cd03247	178	ABCC_cytochrome_bd The CYD subfamily implicated in	96.34
PRK13851	344	type IV secretion system protein VirB11; Provision	96.34
cd03223	166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	96.33
COG0572	218	Udk Uridine kinase [Nucleotide transport and metab	96.33
PRK14239	252	phosphate transporter ATP-binding protein; Provisi	96.32
TIGR01184	230	ntrCD nitrate transport ATP-binding subunits C and	96.32
COG1119	257	ModF ABC-type molybdenum transport system, ATPase	96.32
cd03252	237	ABCC_Hemolysin The ABC-transporter hemolysin B is	96.32
cd03215	182	ABC_Carb_Monos_II This family represents domain II	96.32
PRK13649	280	cbiO cobalt transporter ATP-binding subunit; Provi	96.32
PRK14273	254	phosphate ABC transporter ATP-binding protein; Pro	96.31
cd01854	287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	96.31
PRK11264	250	putative amino-acid ABC transporter ATP-binding pr	96.31
PRK11650	356	ugpC glycerol-3-phosphate transporter ATP-binding	96.31
PRK11432	351	fbpC ferric transporter ATP-binding subunit; Provi	96.3
PRK14267	253	phosphate ABC transporter ATP-binding protein; Pro	96.3
COG4987	573	CydC ABC-type transport system involved in cytochr	96.3
cd03295	242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	96.3
PRK13645	289	cbiO cobalt transporter ATP-binding subunit; Provi	96.29
cd03245	220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	96.29
PRK06547	172	hypothetical protein; Provisional	96.29
PRK14250	241	phosphate ABC transporter ATP-binding protein; Pro	96.28
cd03283	199	ABC_MutS-like MutS-like homolog in eukaryotes. The	96.28
cd03246	173	ABCC_Protease_Secretion This family represents the	96.28
PF00910	107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	96.28
PRK06995	484	flhF flagellar biosynthesis regulator FlhF; Valida	96.28
PRK10418	254	nikD nickel transporter ATP-binding protein NikD;	96.28
cd03221	144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	96.27
CHL00131	252	ycf16 sulfate ABC transporter protein; Validated	96.27
cd03267	236	ABC_NatA_like Similar in sequence to NatA, this is	96.27
PRK14274	259	phosphate ABC transporter ATP-binding protein; Pro	96.27
cd03270	226	ABC_UvrA_I The excision repair protein UvrA domain	96.27
PRK10744	260	pstB phosphate transporter ATP-binding protein; Pr	96.27
PRK13543	214	cytochrome c biogenesis protein CcmA; Provisional	96.26
TIGR01425	429	SRP54_euk signal recognition particle protein SRP5	96.26
PRK14241	258	phosphate transporter ATP-binding protein; Provisi	96.26
TIGR03411	242	urea_trans_UrtD urea ABC transporter, ATP-binding	96.26
PRK14262	250	phosphate ABC transporter ATP-binding protein; Pro	96.26
COG0552	340	FtsY Signal recognition particle GTPase [Intracell	96.26
TIGR02770	230	nickel_nikD nickel import ATP-binding protein NikD	96.26
TIGR00635	305	ruvB Holliday junction DNA helicase, RuvB subunit.	96.25
PRK10575	265	iron-hydroxamate transporter ATP-binding subunit;	96.25
PRK13947	171	shikimate kinase; Provisional	96.25
PRK09580	248	sufC cysteine desulfurase ATPase component; Review	96.25
cd03234	226	ABCG_White The White subfamily represents ABC tran	96.25
TIGR02769	265	nickel_nikE nickel import ATP-binding protein NikE	96.24
PRK15112	267	antimicrobial peptide ABC system ATP-binding prote	96.24
cd01918	149	HprK_C HprK/P, the bifunctional histidine-containi	96.24
PRK15056	272	manganese/iron transporter ATP-binding protein; Pr	96.24
cd03220	224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	96.24
PRK11701	258	phnK phosphonate C-P lyase system protein PhnK; Pr	96.24
cd03231	201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	96.24
cd03240	204	ABC_Rad50 The catalytic domains of Rad50 are simil	96.23
PRK11300	255	livG leucine/isoleucine/valine transporter ATP-bin	96.23
TIGR03005	252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	96.23
COG4619	223	ABC-type uncharacterized transport system, ATPase	96.22
PRK05703	424	flhF flagellar biosynthesis regulator FlhF; Valida	96.22
PRK10751	173	molybdopterin-guanine dinucleotide biosynthesis pr	96.22
cd01128	249	rho_factor Transcription termination factor rho is	96.22
PRK11831	269	putative ABC transporter ATP-binding protein YrbF;	96.22
cd01428	194	ADK Adenylate kinase (ADK) catalyzes the reversibl	96.21
PRK14261	253	phosphate ABC transporter ATP-binding protein; Pro	96.21
TIGR02324	224	CP_lyasePhnL phosphonate C-P lyase system protein	96.21
cd00880	163	Era_like Era (E. coli Ras-like protein)-like. This	96.21
PRK09544	251	znuC high-affinity zinc transporter ATPase; Review	96.21
PF01695	178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.2
cd03236	255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	96.2
PRK10771	232	thiQ thiamine transporter ATP-binding subunit; Pro	96.2
PRK11000	369	maltose/maltodextrin transporter ATP-binding prote	96.2
PRK14531	183	adenylate kinase; Provisional	96.2
TIGR00972	247	3a0107s01c2 phosphate ABC transporter, ATP-binding	96.2
PLN02772	398	guanylate kinase	96.2
PRK12298	390	obgE GTPase CgtA; Reviewed	96.2
PRK13632	271	cbiO cobalt transporter ATP-binding subunit; Provi	96.2
TIGR03265	353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	96.2
PRK14240	250	phosphate transporter ATP-binding protein; Provisi	96.2
cd03248	226	ABCC_TAP TAP, the Transporter Associated with Anti	96.19
cd02021	150	GntK Gluconate kinase (GntK) catalyzes the phospho	96.19
cd03294	269	ABC_Pro_Gly_Bertaine This family comprises the gly	96.19
PRK14259	269	phosphate ABC transporter ATP-binding protein; Pro	96.19
COG1484	254	DnaC DNA replication protein [DNA replication, rec	96.18
PRK11144	352	modC molybdate transporter ATP-binding protein; Pr	96.18
PTZ00088	229	adenylate kinase 1; Provisional	96.18
smart00053	240	DYNc Dynamin, GTPase. Large GTPases that mediate v	96.17
PF03205	140	MobB: Molybdopterin guanine dinucleotide synthesis	96.17
COG1220	444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	96.17
TIGR01288	303	nodI ATP-binding ABC transporter family nodulation	96.17
COG4136	213	ABC-type uncharacterized transport system, ATPase	96.17
TIGR00150	133	HI0065_YjeE ATPase, YjeE family. Members of this f	96.16
TIGR03740	223	galliderm_ABC gallidermin-class lantibiotic protec	96.16
cd03251	234	ABCC_MsbA MsbA is an essential ABC transporter, cl	96.15
PRK09452	375	potA putrescine/spermidine ABC transporter ATPase	96.15
cd01855	190	YqeH YqeH. YqeH is an essential GTP-binding protei	96.15
cd03279	213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	96.15
PRK09825	176	idnK D-gluconate kinase; Provisional	96.15
cd03228	171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	96.15
cd01124	187	KaiC KaiC is a circadian clock protein primarily f	96.14
cd00227	175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	96.14
PRK09493	240	glnQ glutamine ABC transporter ATP-binding protein	96.14
KOG0060|consensus	659		96.13
PRK11607	377	potG putrescine transporter ATP-binding subunit; P	96.13
PF13476	202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	96.13
TIGR03771	223	anch_rpt_ABC anchored repeat-type ABC transporter,	96.13
cd03243	202	ABC_MutS_homologs The MutS protein initiates DNA m	96.13
cd03253	236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	96.13
PRK14237	267	phosphate transporter ATP-binding protein; Provisi	96.13
PRK13548	258	hmuV hemin importer ATP-binding subunit; Provision	96.12
PTZ00258	390	GTP-binding protein; Provisional	96.12
PRK14256	252	phosphate ABC transporter ATP-binding protein; Pro	96.12
PRK00131	175	aroK shikimate kinase; Reviewed	96.11
cd03217	200	ABC_FeS_Assembly ABC-type transport system involve	96.11
TIGR01351	210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	96.11
PRK13646	286	cbiO cobalt transporter ATP-binding subunit; Provi	96.11
PRK15093	330	antimicrobial peptide ABC transporter ATP-binding	96.1
PRK15064	530	ABC transporter ATP-binding protein; Provisional	96.1
COG1118	345	CysA ABC-type sulfate/molybdate transport systems,	96.1
PRK10253	265	iron-enterobactin transporter ATP-binding protein;	96.1
cd03244	221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	96.1
TIGR01277	213	thiQ thiamine ABC transporter, ATP-binding protein	96.1
TIGR01188	302	drrA daunorubicin resistance ABC transporter ATP-b	96.1
PRK14244	251	phosphate ABC transporter ATP-binding protein; Pro	96.09
cd03290	218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	96.09
PLN02165	334	adenylate isopentenyltransferase	96.09
PRK11174	588	cysteine/glutathione ABC transporter membrane/ATP-	96.08
PRK13648	269	cbiO cobalt transporter ATP-binding subunit; Provi	96.08
PRK09984	262	phosphonate/organophosphate ester transporter subu	96.08
cd00464	154	SK Shikimate kinase (SK) is the fifth enzyme in th	96.08

>KOG0084|consensus

Probab=99.60  E-value=2.3e-15  Score=90.99  Aligned_cols=50  Identities=22%  Similarity=0.275  Sum_probs=44.5

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      +...++.||++++||+|||||||+.|      |..+.|.+.|.+||| ||+-.++++
T Consensus         3 ~~~~dylFKiiliGds~VGKtCL~~R------f~~~~f~e~~~sTIG-VDf~~rt~e   52 (205)
T KOG0084|consen    3 NPEYDYLFKIILIGDSGVGKTCLLLR------FKDDTFTESYISTIG-VDFKIRTVE   52 (205)
T ss_pred             CcccceEEEEEEECCCCcChhhhhhh------hccCCcchhhcceee-eEEEEEEee
Confidence            45678999999999999999999998      999999999999999 887765554

>KOG0094|consensus

Probab=99.50  E-value=4.5e-14  Score=85.65  Aligned_cols=50  Identities=28%  Similarity=0.224  Sum_probs=44.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEecC
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE   65 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i~~   65 (65)
                      .-..+|++++||.+||||||+.|      |+.+.|...|.+||| +||.+.+..+.|
T Consensus        19 ~~k~~KlVflGdqsVGKTslItR------f~yd~fd~~YqATIG-iDFlskt~~l~d   68 (221)
T KOG0094|consen   19 PLKKYKLVFLGDQSVGKTSLITR------FMYDKFDNTYQATIG-IDFLSKTMYLED   68 (221)
T ss_pred             cceEEEEEEEccCccchHHHHHH------HHHhhhcccccceee-eEEEEEEEEEcC
Confidence            34559999999999999999998      999999999999999 999998876654

>KOG0078|consensus

Probab=99.47  E-value=1.9e-13  Score=83.16  Aligned_cols=52  Identities=27%  Similarity=0.295  Sum_probs=46.8

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ...++++.+|++++||++|||||++.|      |.++.|...|..||| |||..+++.+
T Consensus         5 ~~~~~d~~~kvlliGDs~vGKt~~l~r------f~d~~f~~~~~sTiG-IDFk~kti~l   56 (207)
T KOG0078|consen    5 AKEDYDYLFKLLLIGDSGVGKTCLLLR------FSDDSFNTSFISTIG-IDFKIKTIEL   56 (207)
T ss_pred             ccCCcceEEEEEEECCCCCchhHhhhh------hhhccCcCCccceEE-EEEEEEEEEe
Confidence            344788999999999999999999998      999999999999999 8998877764

>KOG0394|consensus

Probab=99.37  E-value=4.8e-13  Score=80.63  Aligned_cols=49  Identities=22%  Similarity=0.283  Sum_probs=42.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .....+||+++||+|||||||+.+      |..+.|...|..||| +||..+.+.|
T Consensus         5 ~K~~lLKViiLGDsGVGKtSLmn~------yv~~kF~~qykaTIg-adFltKev~V   53 (210)
T KOG0394|consen    5 RKRTLLKVIILGDSGVGKTSLMNQ------YVNKKFSQQYKATIG-ADFLTKEVQV   53 (210)
T ss_pred             CcccceEEEEeCCCCccHHHHHHH------HHHHHHHHHhccccc-hhheeeEEEE
Confidence            446679999999999999999998      999999999999999 7887766554

>KOG0080|consensus

Probab=99.37  E-value=2.7e-12  Score=76.46  Aligned_cols=49  Identities=18%  Similarity=0.228  Sum_probs=42.7

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ..+...+|++++|++|||||||+.|      |..+.|.+....||| +||..+...
T Consensus         6 s~~~~t~KiLlIGeSGVGKSSLllr------Fv~~~fd~~~~~tIG-vDFkvk~m~   54 (209)
T KOG0080|consen    6 SGYDTTFKILLIGESGVGKSSLLLR------FVSNTFDDLHPTTIG-VDFKVKVMQ   54 (209)
T ss_pred             cCcceeEEEEEEccCCccHHHHHHH------HHhcccCccCCceee-eeEEEEEEE
Confidence            4567789999999999999999998      999999999999999 777666544

>KOG0098|consensus

Probab=99.34  E-value=2.5e-12  Score=77.75  Aligned_cols=50  Identities=24%  Similarity=0.330  Sum_probs=42.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee---------EEEEEEecC
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ---------YRIYKDTLE   65 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~---------~~~~~~i~~   65 (65)
                      +.+.+|++++||.|||||||+.|      |+.+.|.+.+..|+| +|+         ...+++|||
T Consensus         3 ~~~~fKyIiiGd~gVGKSclllr------f~~krF~~~hd~TiG-vefg~r~~~id~k~IKlqiwD   61 (216)
T KOG0098|consen    3 YAYLFKYIIIGDTGVGKSCLLLR------FTDKRFQPVHDLTIG-VEFGARMVTIDGKQIKLQIWD   61 (216)
T ss_pred             ccceEEEEEECCCCccHHHHHHH------HhccCccccccceee-eeeceeEEEEcCceEEEEEEe
Confidence            46789999999999999999998      999999999999998 565         445555665

>KOG0087|consensus

Probab=99.31  E-value=5.7e-12  Score=77.07  Aligned_cols=51  Identities=24%  Similarity=0.324  Sum_probs=45.0

Q ss_pred             CCCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257          4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus         4 ~~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      +.+...++.||++++||++||||.|+.|      |..++|..+-.+||| +|+.+.++
T Consensus         6 ~~~~~~dylFKiVliGDS~VGKsnLlsR------ftrnEF~~~SksTIG-vef~t~t~   56 (222)
T KOG0087|consen    6 DKSEEYDYLFKIVLIGDSAVGKSNLLSR------FTRNEFSLESKSTIG-VEFATRTV   56 (222)
T ss_pred             CCccccceEEEEEEeCCCccchhHHHHH------hcccccCccccccee-EEEEeece
Confidence            3456789999999999999999999998      999999999999999 88887544

>KOG0092|consensus

Probab=99.28  E-value=6.5e-12  Score=75.86  Aligned_cols=46  Identities=24%  Similarity=0.269  Sum_probs=39.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ...+|++++|+++||||||+.|      |..+.|.+...|||| .-|+++++.
T Consensus         3 ~~~~KvvLLG~~~VGKSSlV~R------fvk~~F~e~~e~TIG-aaF~tktv~   48 (200)
T KOG0092|consen    3 TREFKVVLLGDSGVGKSSLVLR------FVKDQFHENIEPTIG-AAFLTKTVT   48 (200)
T ss_pred             cceEEEEEECCCCCCchhhhhh------hhhCccccccccccc-cEEEEEEEE
Confidence            3569999999999999999998      999999999999999 566665544

>KOG0393|consensus

Probab=99.28  E-value=1.9e-12  Score=78.51  Aligned_cols=45  Identities=42%  Similarity=0.636  Sum_probs=42.6

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ...|++++||++|||||++..      |..+.|+..|.||++  |+|++.+.|
T Consensus         3 ~~~K~VvVGDga~GKT~ll~~------~t~~~fp~~yvPTVF--dnys~~v~V   47 (198)
T KOG0393|consen    3 RRIKCVVVGDGAVGKTCLLIS------YTTNAFPEEYVPTVF--DNYSANVTV   47 (198)
T ss_pred             eeeEEEEECCCCcCceEEEEE------eccCcCcccccCeEE--ccceEEEEe
Confidence            468999999999999999998      999999999999999  999999887

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily

Probab=99.28  E-value=1e-11  Score=73.87  Aligned_cols=44  Identities=34%  Similarity=0.452  Sum_probs=37.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ...+|++++|++|||||||+.|      |..+.|..+|.||++  +.|...+
T Consensus         3 ~~~~KivvvGd~~vGKTsli~~------~~~~~f~~~~~pT~~--~~~~~~~   46 (182)
T cd04172           3 NVKCKIVVVGDSQCGKTALLHV------FAKDCFPENYVPTVF--ENYTASF   46 (182)
T ss_pred             cceEEEEEECCCCCCHHHHHHH------HHhCCCCCccCCcee--eeeEEEE
Confidence            4568999999999999999998      888999999999998  6665443

Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7. Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I. Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol. Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation. In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell. In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint. Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation. In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight

>cd01875 RhoG RhoG subfamily

Probab=99.27  E-value=9.6e-12  Score=73.99  Aligned_cols=40  Identities=45%  Similarity=0.732  Sum_probs=35.9

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|+++||||+|+.|      |..+.|...|.||++  +.|..
T Consensus         3 ~~ki~~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~~   42 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLIC------YTTNAFPKEYIPTVF--DNYSA   42 (191)
T ss_pred             cEEEEEECCCCCCHHHHHHH------HHhCCCCcCCCCceE--eeeEE
Confidence            48999999999999999998      999999999999999  66653

RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding. However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif. Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1. The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor. Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology. RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists. Most Rho proteins contain a lipid modification site at the C-termin

>cd01874 Cdc42 Cdc42 subfamily

Probab=99.26  E-value=1.1e-11  Score=72.88  Aligned_cols=39  Identities=49%  Similarity=0.833  Sum_probs=35.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.|||||||+.+      |..+.|...|.||++  +.|..
T Consensus         2 ~ki~vvG~~~vGKTsl~~~------~~~~~f~~~~~pt~~--~~~~~   40 (175)
T cd01874           2 IKCVVVGDGAVGKTCLLIS------YTTNKFPSEYVPTVF--DNYAV   40 (175)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee--eeeEE
Confidence            6999999999999999998      888889889999998  66653

Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases. These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway. Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth. In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus. Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand. In addi

>cd01873 RhoBTB RhoBTB subfamily

Probab=99.25  E-value=1.9e-11  Score=73.41  Aligned_cols=47  Identities=81%  Similarity=1.316  Sum_probs=37.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+||+++|+++||||||+.+++++..|..+.|..+|.||++.+++|.
T Consensus         2 ~~Kiv~vG~~~vGKTsLi~~~~~~~~~~~~~f~~~~~pTi~~~~~~~   48 (195)
T cd01873           2 TIKCVVVGDNAVGKTRLICARACNKTLTQYQLLATHVPTVWAIDQYR   48 (195)
T ss_pred             ceEEEEECCCCcCHHHHHHHHHhCCCcccccCccccCCceeccccee
Confidence            47999999999999999976666666666778888999997334443

Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium. RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function. RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades. RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors. Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs. Thus, the Dictyostelium RacA is not included here. Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.

>KOG0079|consensus

Probab=99.23  E-value=3.9e-12  Score=74.96  Aligned_cols=49  Identities=22%  Similarity=0.301  Sum_probs=43.5

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .++..+|.+++||+|||||+|+.|      |..+.|...|..|+| +|+..+++.|
T Consensus         4 ~~dhLfkllIigDsgVGKssLl~r------F~ddtFs~sYitTiG-vDfkirTv~i   52 (198)
T KOG0079|consen    4 DYDHLFKLLIIGDSGVGKSSLLLR------FADDTFSGSYITTIG-VDFKIRTVDI   52 (198)
T ss_pred             cHHHHHHHHeecCCcccHHHHHHH------HhhcccccceEEEee-eeEEEEEeec
Confidence            345678999999999999999998      999999999999999 8988877664

>cd04131 Rnd Rnd subfamily

Probab=99.23  E-value=2.3e-11  Score=71.94  Aligned_cols=40  Identities=40%  Similarity=0.530  Sum_probs=35.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|++|||||||+.+      |..+.|...|.||++  +.|...
T Consensus         2 ~Kiv~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~~~   41 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQV------FAKDCYPETYVPTVF--ENYTAS   41 (178)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCcCCCCcCCceE--EEEEEE
Confidence            7999999999999999998      888899999999998  666533

The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8. These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos. Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated. In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity. They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily

Probab=99.23  E-value=3.1e-11  Score=74.52  Aligned_cols=45  Identities=33%  Similarity=0.445  Sum_probs=38.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +....+|++++|++|||||||+.+      |..+.|...|.||++  +.|...
T Consensus         9 ~~~~~~KIvvvGd~~VGKTsLi~r------~~~~~F~~~y~pTi~--~~~~~~   53 (232)
T cd04174           9 PLVMRCKLVLVGDVQCGKTAMLQV------LAKDCYPETYVPTVF--ENYTAG   53 (232)
T ss_pred             CceeeEEEEEECCCCCcHHHHHHH------HhcCCCCCCcCCcee--eeeEEE
Confidence            445678999999999999999998      888999999999998  666543

Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8. Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active. In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation. Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy. Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd04133 Rop_like Rop subfamily

Probab=99.19  E-value=3.8e-11  Score=71.14  Aligned_cols=40  Identities=40%  Similarity=0.706  Sum_probs=35.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||+|+.|      |..+.|..+|.||++  +.|...
T Consensus         2 ~kivv~G~~~vGKTsli~~------~~~~~f~~~~~~Ti~--~~~~~~   41 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLIC------YTSNKFPTDYIPTVF--DNFSAN   41 (176)
T ss_pred             eEEEEECCCCCcHHHHHHH------HhcCCCCCCCCCcce--eeeEEE
Confidence            6999999999999999998      999999999999998  666543

The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance. Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade. They transmit a variety of extracellular and intracellular signals. Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility. An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins. For example,

>cd04128 Spg1 Spg1p

Probab=99.19  E-value=4e-11  Score=71.10  Aligned_cols=40  Identities=20%  Similarity=0.286  Sum_probs=34.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||||+.|      |..+.|..+|.||++ .+++.+
T Consensus         1 ~Ki~vlG~~~vGKTsLi~~------~~~~~f~~~~~~T~g-~~~~~~   40 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVK------YVEGEFDEDYIQTLG-VNFMEK   40 (182)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eEEEEE
Confidence            5899999999999999998      888889989999998 455443

Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are

>KOG0095|consensus

Probab=99.18  E-value=5.5e-11  Score=70.37  Aligned_cols=49  Identities=24%  Similarity=0.234  Sum_probs=43.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .+...||++++|..|||||||+.|      |..+-|+.....||| +||-.++++|
T Consensus         3 dykflfkivlvgnagvgktclvrr------ftqglfppgqgatig-vdfmiktvev   51 (213)
T KOG0095|consen    3 DYKFLFKIVLVGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFMIKTVEV   51 (213)
T ss_pred             ccceeEEEEEEccCCcCcchhhhh------hhccCCCCCCCceee-eeEEEEEEEE
Confidence            356789999999999999999998      999999999999999 8988877664

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily

Probab=99.18  E-value=3.3e-11  Score=73.94  Aligned_cols=39  Identities=38%  Similarity=0.568  Sum_probs=35.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||||+.+      |..+.|+..|.||++  +.|..
T Consensus         2 ~KIvvvGd~~vGKTsLi~~------~~~~~f~~~y~pTi~--~~~~~   40 (222)
T cd04173           2 CKIVVVGDAECGKTALLQV------FAKDAYPGSYVPTVF--ENYTA   40 (222)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCccCCccc--cceEE
Confidence            7999999999999999998      888899999999998  66653

Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8. Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex. These migrating cells typically develop into pyramidal neurons. Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration. The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching. Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction. Rnd2/Rho7 is also found to be expressed in sperma

>PLN03110 Rab GTPase; Provisional

Probab=99.16  E-value=1.7e-10  Score=69.96  Aligned_cols=52  Identities=19%  Similarity=0.305  Sum_probs=40.6

Q ss_pred             CCCCCCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          1 MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         1 m~~~~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      |..+..+...+.+|++++|++|||||+|+.+      +..+.|...+.||++ +++...
T Consensus         1 ~~~~~~~~~~~~~Ki~ivG~~~vGKStLi~~------l~~~~~~~~~~~t~g-~~~~~~   52 (216)
T PLN03110          1 MAHRVDHEYDYLFKIVLIGDSGVGKSNILSR------FTRNEFCLESKSTIG-VEFATR   52 (216)
T ss_pred             CCCCcccccCceeEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEE
Confidence            3444555566789999999999999999997      877778778889988 555443

>PLN03071 GTP-binding nuclear protein Ran; Provisional

Probab=99.14  E-value=1.3e-10  Score=70.69  Aligned_cols=43  Identities=23%  Similarity=0.289  Sum_probs=36.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ...+|++++|++|||||+|+.+      |..+.|...|.||++ ++.+..
T Consensus        11 ~~~~Ki~vvG~~gvGKTsli~~------~~~~~f~~~~~~tig-~~~~~~   53 (219)
T PLN03071         11 YPSFKLVIVGDGGTGKTTFVKR------HLTGEFEKKYEPTIG-VEVHPL   53 (219)
T ss_pred             CCceEEEEECcCCCCHHHHHHH------HhhCCCCCccCCccc-eeEEEE
Confidence            5678999999999999999998      888889888999998 555543

>cd01892 Miro2 Miro2 subfamily

Probab=99.14  E-value=9.9e-11  Score=68.35  Aligned_cols=37  Identities=24%  Similarity=0.395  Sum_probs=33.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +..+|++++|++|||||+|+.|      |..+.|. .+|.||++
T Consensus         2 ~~~~kv~~vG~~~vGKTsli~~------~~~~~f~~~~~~~T~~   39 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRA------FLGRSFSLNAYSPTIK   39 (169)
T ss_pred             CeEEEEEEECCCCCcHHHHHHH------HhCCCCCcccCCCccC
Confidence            4568999999999999999998      8888888 88999987

Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the putative GTPase domain in the C terminus of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.

>cd04121 Rab40 Rab40 subfamily

Probab=99.12  E-value=2.2e-10  Score=68.64  Aligned_cols=44  Identities=23%  Similarity=0.252  Sum_probs=35.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ....+|++++|+.|||||+|+.+      |..+.|...|.|+++ .+++..
T Consensus         3 ~~~~~KivviG~~~vGKTsll~~------~~~~~~~~~~~~t~~-~~~~~~   46 (189)
T cd04121           3 YDYLLKFLLVGDSDVGKGEILAS------LQDGSTESPYGYNMG-IDYKTT   46 (189)
T ss_pred             CCceeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcce-eEEEEE
Confidence            34669999999999999999998      888888888888887 444433

This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous. In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle. Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components. Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide d

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily

Probab=99.09  E-value=1.8e-10  Score=67.48  Aligned_cols=41  Identities=27%  Similarity=0.345  Sum_probs=35.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      .+|++++|+.|||||+|+.+      |..+.|...+.||++  +.+...
T Consensus         2 ~~ki~vvG~~~vGKTsL~~~------~~~~~f~~~~~~t~~--~~~~~~   42 (172)
T cd04141           2 EYKIVMLGAGGVGKSAVTMQ------FISHSFPDYHDPTIE--DAYKQQ   42 (172)
T ss_pred             ceEEEEECCCCCcHHHHHHH------HHhCCCCCCcCCccc--ceEEEE
Confidence            37999999999999999998      888888888999998  666543

Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to sign

>KOG0086|consensus

Probab=99.09  E-value=9.7e-11  Score=69.51  Aligned_cols=48  Identities=17%  Similarity=0.189  Sum_probs=42.0

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +...+++.+|++++|++|.|||||+++      |..+.|.+.-..||| +||-+.
T Consensus         2 msEtYDyLfKfl~iG~aGtGKSCLLh~------Fie~kfkDdssHTiG-veFgSr   49 (214)
T KOG0086|consen    2 MSETYDYLFKFLVIGSAGTGKSCLLHQ------FIENKFKDDSSHTIG-VEFGSR   49 (214)
T ss_pred             cchhhhhhheeEEeccCCCChhHHHHH------HHHhhhcccccceee-eeecce
Confidence            345688999999999999999999998      999999998889998 787654

>cd04120 Rab12 Rab12 subfamily

Probab=99.09  E-value=2.2e-10  Score=69.28  Aligned_cols=41  Identities=20%  Similarity=0.223  Sum_probs=34.9

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .++++|++|||||||+.|      |..+.|...|.||++ ++++...+
T Consensus         2 ~vvvlG~~gVGKTSli~r------~~~~~f~~~~~~Ti~-~~~~~~~i   42 (202)
T cd04120           2 QVIIIGSRGVGKTSLMRR------FTDDTFCEACKSGVG-VDFKIKTV   42 (202)
T ss_pred             EEEEECcCCCCHHHHHHH------HHhCCCCCcCCCcce-eEEEEEEE
Confidence            589999999999999998      888999999999998 56655443

Rab12 was first identified in canine cells, where it was localized to the Golgi complex. The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported. More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily

Probab=99.08  E-value=3.4e-10  Score=66.20  Aligned_cols=39  Identities=33%  Similarity=0.302  Sum_probs=34.1

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ||+++|+.|||||+|+.+      |..+.|..+|.||++ .+++..
T Consensus         2 ki~ivG~~~vGKTsli~~------~~~~~f~~~~~~t~~-~~~~~~   40 (170)
T cd04108           2 KVIVVGDLSVGKTCLINR------FCKDVFDKNYKATIG-VDFEME   40 (170)
T ss_pred             EEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-eEEEEE
Confidence            899999999999999998      888899999999998 455433

Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice. This isoform is associated with membrane ruffles and promotes macropinosome formation. Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further re

>cd01871 Rac1_like Rac1-like subfamily

Probab=99.08  E-value=2.5e-10  Score=67.03  Aligned_cols=39  Identities=46%  Similarity=0.764  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.+||||+|+.|      |..+.|...|.||++  +.|..
T Consensus         2 ~ki~iiG~~~vGKSsli~~------~~~~~f~~~~~~t~~--~~~~~   40 (174)
T cd01871           2 IKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYSA   40 (174)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhcCCCCCcCCCcce--eeeEE
Confidence            6999999999999999998      888889889999987  66553

The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1. While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively. Rac1 stimulates the formation of actin lamellipodia and membrane ruffles. It also plays a role in cell-matrix adhesion and cell anoikis. In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis. Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation. In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis. Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily

Probab=99.08  E-value=2.3e-10  Score=64.95  Aligned_cols=39  Identities=36%  Similarity=0.480  Sum_probs=33.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||+|+.+      +..+.|...+.||++  +.+..
T Consensus         2 ~ki~iiG~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~   40 (162)
T cd04138           2 YKLVVVGAGGVGKSALTIQ------LIQNHFVDEYDPTIE--DSYRK   40 (162)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCcCCcCCcch--heEEE
Confidence            6999999999999999997      777788888888887  55543

H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family. These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation. Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers. Many Ras guanine nucleotide exchange factors (GEFs) have been identified. They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities. Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.

>cd04109 Rab28 Rab28 subfamily

Probab=99.07  E-value=3.3e-10  Score=68.42  Aligned_cols=42  Identities=31%  Similarity=0.305  Sum_probs=36.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      +|++++|+++||||+|+.+      |..+.|...|.||++ +|++...+
T Consensus         1 ~Ki~ivG~~~vGKSsLi~~------l~~~~~~~~~~~T~~-~d~~~~~i   42 (215)
T cd04109           1 FKIVVLGDGAVGKTSLCRR------FAKEGFGKSYKQTIG-LDFFSKRV   42 (215)
T ss_pred             CEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEEEE
Confidence            5899999999999999998      888889999999998 67766544

First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA). In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos. Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus. The two human isoforms are presumbly the result of alternative splicing. Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs

>cd04127 Rab27A Rab27a subfamily

Probab=99.07  E-value=4.5e-10  Score=65.38  Aligned_cols=41  Identities=29%  Similarity=0.416  Sum_probs=35.2

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +.+|++++|+++||||+|+.+      +..+.|...+.||++ +++..
T Consensus         3 ~~~ki~ivG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   43 (180)
T cd04127           3 YLIKFLALGDSGVGKTSFLYQ------YTDNKFNPKFITTVG-IDFRE   43 (180)
T ss_pred             ceEEEEEECCCCCCHHHHHHH------HhcCCCCccCCCccc-eEEEE
Confidence            568999999999999999998      888888888999987 45543

The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b. Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions. Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder. When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily

Probab=99.06  E-value=4.2e-10  Score=67.19  Aligned_cols=39  Identities=28%  Similarity=0.306  Sum_probs=33.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      |..+.|...+.||++ .+++.
T Consensus         1 ~KivivG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~d~~~   39 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKR------YVHGIFSQHYKATIG-VDFAL   39 (201)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee-EEEEE
Confidence            5899999999999999998      888888888999998 45443

Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>KOG0093|consensus

Probab=99.06  E-value=2.9e-10  Score=67.06  Aligned_cols=47  Identities=26%  Similarity=0.359  Sum_probs=41.8

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +++.++.+|++++|++.|||||++.|      |..+.|...|.+|+| |+|..+
T Consensus        15 dqnFDymfKlliiGnssvGKTSfl~r------y~ddSFt~afvsTvG-idFKvK   61 (193)
T KOG0093|consen   15 DQNFDYMFKLLIIGNSSVGKTSFLFR------YADDSFTSAFVSTVG-IDFKVK   61 (193)
T ss_pred             cccccceeeEEEEccCCccchhhhHH------hhccccccceeeeee-eeEEEe
Confidence            44668889999999999999999998      999999999999999 786544

>KOG0091|consensus

Probab=99.05  E-value=2.1e-10  Score=68.60  Aligned_cols=43  Identities=26%  Similarity=0.421  Sum_probs=38.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..+.|+++++||+.||||||++.      |..+.|..--.||+| +|||.
T Consensus         5 f~yqfrlivigdstvgkssll~~------ft~gkfaelsdptvg-vdffa   47 (213)
T KOG0091|consen    5 FHYQFRLIVIGDSTVGKSSLLRY------FTEGKFAELSDPTVG-VDFFA   47 (213)
T ss_pred             eEEEEEEEEEcCCcccHHHHHHH------HhcCcccccCCCccc-hHHHH
Confidence            35789999999999999999997      999999998899999 88764

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases

Probab=99.05  E-value=1.8e-10  Score=65.97  Aligned_cols=42  Identities=40%  Similarity=0.528  Sum_probs=35.7

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ||+++|+.+||||+|+.+      |..+.|...+.||++ .+.+...+.
T Consensus         1 Ki~vvG~~~vGKtsl~~~------~~~~~~~~~~~~t~~-~~~~~~~~~   42 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINR------LINGEFPENYIPTIG-IDSYSKEVS   42 (162)
T ss_dssp             EEEEEESTTSSHHHHHHH------HHHSSTTSSSETTSS-EEEEEEEEE
T ss_pred             CEEEECCCCCCHHHHHHH------HHhhccccccccccc-ccccccccc
Confidence            899999999999999998      888888899999985 476665554

This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including: Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....

>cd04136 Rap_like Rap-like subfamily

Probab=99.05  E-value=2.6e-10  Score=65.10  Aligned_cols=40  Identities=33%  Similarity=0.432  Sum_probs=33.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||||+.+      +..+.|...+.||++  +.+...
T Consensus         2 ~ki~i~G~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~~   41 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYRKQ   41 (163)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCchh--hhEEEE
Confidence            7999999999999999997      777778888888876  555543

The Rap subfamily consists of the Rap1, Rap2, and RSR1. Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines. Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands. In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres.

>cd04102 RabL3 RabL3 (Rab-like3) subfamily

Probab=99.05  E-value=4.6e-10  Score=68.03  Aligned_cols=34  Identities=38%  Similarity=0.502  Sum_probs=31.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|||||||+.+      |..+.|...+.||++
T Consensus         1 vKIvlvGd~gVGKTSLi~~------~~~~~f~~~~~~Tig   34 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHL------ICKNQVLGRPSWTVG   34 (202)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCCCCCccee
Confidence            4899999999999999998      888889888999998

RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like. As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus. The specific function of RabL3 remains unknown.

>cd04117 Rab15 Rab15 subfamily

Probab=99.04  E-value=6e-10  Score=64.37  Aligned_cols=38  Identities=29%  Similarity=0.614  Sum_probs=33.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|++|+|||+|+.+      +..+.|...+.||++ .+.+
T Consensus         1 ~ki~vvG~~~~GKTsli~~------~~~~~~~~~~~~t~~-~~~~   38 (161)
T cd04117           1 FRLLLIGDSGVGKTCLLCR------FTDNEFHSSHISTIG-VDFK   38 (161)
T ss_pred             CEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCcee-eEEE
Confidence            5899999999999999998      888888888999998 4444

Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to

>PLN00023 GTP-binding protein; Provisional

Probab=99.04  E-value=6.9e-10  Score=71.78  Aligned_cols=45  Identities=24%  Similarity=0.285  Sum_probs=37.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .....+||+++|++|||||||+.+      |..+.|...+.||+| .+++.+
T Consensus        17 ~~~~~iKIVLLGdsGVGKTSLI~r------f~~g~F~~~~~pTIG-~d~~ik   61 (334)
T PLN00023         17 PPCGQVRVLVVGDSGVGKSSLVHL------IVKGSSIARPPQTIG-CTVGVK   61 (334)
T ss_pred             CCccceEEEEECCCCCcHHHHHHH------HhcCCcccccCCcee-eeEEEE
Confidence            445679999999999999999998      888889889999998 455433

>cd04111 Rab39 Rab39 subfamily

Probab=99.03  E-value=6.9e-10  Score=67.13  Aligned_cols=43  Identities=26%  Similarity=0.420  Sum_probs=35.5

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .+||+++|+++||||+|+.+      +..+.|...+.||++ .|++...+
T Consensus         2 ~~KIvvvG~~~vGKTsLi~~------l~~~~~~~~~~~ti~-~d~~~~~i   44 (211)
T cd04111           2 QFRLIVIGDSTVGKSSLLKR------FTEGRFAEVSDPTVG-VDFFSRLI   44 (211)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCceec-eEEEEEEE
Confidence            58999999999999999997      777778888889987 56655433

Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines. It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases

Probab=99.03  E-value=6.1e-10  Score=64.76  Aligned_cols=39  Identities=26%  Similarity=0.292  Sum_probs=32.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      +..+.+...+.||++ ++.+.
T Consensus         1 ~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   39 (166)
T cd00877           1 FKLVLVGDGGTGKTTFVKR------HLTGEFEKKYVATLG-VEVHP   39 (166)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee-eEEEE
Confidence            5899999999999999997      777788888889987 45443

Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is

>cd04110 Rab35 Rab35 subfamily

Probab=99.02  E-value=8.3e-10  Score=65.96  Aligned_cols=41  Identities=24%  Similarity=0.421  Sum_probs=34.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +..+|++++|++|||||||+.+      |..+.|...+.||++ ++..
T Consensus         4 ~~~~kivvvG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~~~~   44 (199)
T cd04110           4 DHLFKLLIIGDSGVGKSSLLLR------FADNTFSGSYITTIG-VDFK   44 (199)
T ss_pred             CceeEEEEECCCCCCHHHHHHH------HhcCCCCCCcCcccc-ceeE
Confidence            4569999999999999999998      888888888889987 4543

Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells. Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is

>PTZ00369 Ras-like protein; Provisional

Probab=99.01  E-value=5.7e-10  Score=66.06  Aligned_cols=40  Identities=35%  Similarity=0.442  Sum_probs=34.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|++|||||||+.+      |..+.|...+.||++  +.|.+
T Consensus         5 ~~Ki~iiG~~~~GKTsLi~~------~~~~~~~~~~~~t~~--~~~~~   44 (189)
T PTZ00369          5 EYKLVVVGGGGVGKSALTIQ------FIQNHFIDEYDPTIE--DSYRK   44 (189)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCCCcCcCCchh--hEEEE
Confidence            58999999999999999998      888888888888887  55554

>cd04119 RJL RJL (RabJ-Like) subfamily

Probab=99.01  E-value=7.9e-10  Score=63.08  Aligned_cols=38  Identities=26%  Similarity=0.457  Sum_probs=32.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|+++||||||+.+      +..+.|...+.||++ .+..
T Consensus         1 ~ki~~vG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~~~~   38 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKR------YCEGRFVSKYLPTIG-IDYG   38 (168)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eeEE
Confidence            4899999999999999998      888888888899987 4443

RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa. RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.

>cd04122 Rab14 Rab14 subfamily

Probab=99.01  E-value=8.9e-10  Score=63.60  Aligned_cols=35  Identities=23%  Similarity=0.450  Sum_probs=31.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+.+||||||+.+      +..+.|...+.||++
T Consensus         2 ~~ki~iiG~~~vGKTsli~~------~~~~~~~~~~~~t~~   36 (166)
T cd04122           2 IFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG   36 (166)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCcccc
Confidence            48999999999999999998      888888888888876

Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GT

>cd04134 Rho3 Rho3 subfamily

Probab=99.00  E-value=7.6e-10  Score=65.60  Aligned_cols=38  Identities=37%  Similarity=0.524  Sum_probs=33.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|++|||||+|+.+      |..+.|...|.||++  +.|.
T Consensus         1 ~kivivG~~~vGKTsli~~------~~~~~~~~~~~~t~~--~~~~   38 (189)
T cd04134           1 RKVVVLGDGACGKTSLLNV------FTRGYFPQVYEPTVF--ENYV   38 (189)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCccCCcce--eeeE
Confidence            3899999999999999998      888888888999987  5554

Rho3 is a member of the Rho family found only in fungi. Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules. Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity. The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>cd04176 Rap2 Rap2 subgroup

Probab=99.00  E-value=5.7e-10  Score=63.99  Aligned_cols=40  Identities=33%  Similarity=0.420  Sum_probs=34.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|++|||||+|+.+      +..+.|...+.||++  +++...
T Consensus         2 ~ki~i~G~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~~   41 (163)
T cd04176           2 YKVVVLGSGGVGKSALTVQ------FVSGTFIEKYDPTIE--DFYRKE   41 (163)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCchh--heEEEE
Confidence            7999999999999999998      888888888888876  665543

The Rap2 subgroup is part of the Rap subfamily of the Ras family. It consists of Rap2a, Rap2b, and Rap2c. Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton. In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments. In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway. The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis. Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation. A number of additional effector proteins for Rap2 have been identified, incl

>KOG0395|consensus

Probab=99.00  E-value=2.6e-10  Score=68.98  Aligned_cols=45  Identities=29%  Similarity=0.348  Sum_probs=41.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ..+|++++|.+|||||+|..+      |..+.|...|.||++  |+|++.+.+
T Consensus         2 ~~~kvvvlG~~gVGKSal~~q------f~~~~f~~~y~ptie--d~y~k~~~v   46 (196)
T KOG0395|consen    2 REYKVVVLGAGGVGKSALTIQ------FLTGRFVEDYDPTIE--DSYRKELTV   46 (196)
T ss_pred             CceEEEEECCCCCCcchheee------ecccccccccCCCcc--ccceEEEEE
Confidence            358999999999999999998      999999999999999  999988875

>PTZ00132 GTP-binding nuclear protein Ran; Provisional

Probab=99.00  E-value=1.1e-09  Score=65.89  Aligned_cols=44  Identities=23%  Similarity=0.297  Sum_probs=36.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .....+|++++|++|+|||||+.+      +..+.|...|.||++ ++...
T Consensus         5 ~~~~~~kv~liG~~g~GKTtLi~~------~~~~~~~~~~~~t~~-~~~~~   48 (215)
T PTZ00132          5 DEVPEFKLILVGDGGVGKTTFVKR------HLTGEFEKKYIPTLG-VEVHP   48 (215)
T ss_pred             cCCCCceEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eEEEE
Confidence            345568999999999999999987      777888888999998 45543

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2

Probab=98.98  E-value=1e-09  Score=63.44  Aligned_cols=36  Identities=28%  Similarity=0.428  Sum_probs=32.1

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+||+++|+++||||+|+.+      +..+.|...|.||++
T Consensus         2 ~~~ki~vvG~~~~GKSsl~~~------~~~~~f~~~~~~t~~   37 (167)
T cd01867           2 YLFKLLLIGDSGVGKSCLLLR------FSEDSFNPSFISTIG   37 (167)
T ss_pred             cceEEEEECCCCCCHHHHHHH------HhhCcCCcccccCcc
Confidence            458999999999999999998      888888888888887

Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhi

>cd04175 Rap1 Rap1 subgroup

Probab=98.98  E-value=8.2e-10  Score=63.47  Aligned_cols=38  Identities=34%  Similarity=0.475  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|+.|||||||+.+      +..+.|...+.||++  +.+.
T Consensus         2 ~ki~~~G~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~   39 (164)
T cd04175           2 YKLVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYR   39 (164)
T ss_pred             cEEEEECCCCCCHHHHHHH------HHhCCCCcccCCcch--heEE
Confidence            7999999999999999997      777778888888887  5444

The Rap1 subgroup is part of the Rap subfamily of the Ras family. It can be further divided into the Rap1a and Rap1b isoforms. In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively. Rap1a is sometimes called smg p21 or Krev1 in the older literature. Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. High expression of Rap1 has been observed in the n

>cd04130 Wrch_1 Wrch-1 subfamily

Probab=98.97  E-value=1.3e-09  Score=63.50  Aligned_cols=39  Identities=46%  Similarity=0.767  Sum_probs=33.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      |..+.|..+|.||+.  +.|..
T Consensus         1 ~k~~i~G~~~~GKtsl~~~------~~~~~~~~~~~~t~~--~~~~~   39 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVS------YTTNGYPTEYVPTAF--DNFSV   39 (173)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeeE
Confidence            5899999999999999998      888888888999986  66654

Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus,

>cd01865 Rab3 Rab3 subfamily

Probab=98.97  E-value=1.9e-09  Score=62.23  Aligned_cols=37  Identities=30%  Similarity=0.463  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      +|++++|+.+||||+|+.+      +..+.|...|.||++ +++
T Consensus         2 ~ki~i~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~   38 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFR------YADDSFTSAFVSTVG-IDF   38 (165)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-eEE
Confidence            7999999999999999998      888888888889887 443

The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D. All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression. Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules. Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot

>cd01870 RhoA_like RhoA-like subfamily

Probab=98.96  E-value=1.2e-09  Score=63.31  Aligned_cols=34  Identities=47%  Similarity=0.586  Sum_probs=30.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .|++++|++|||||+|+.+      |..+.|...|.||++
T Consensus         2 ~ki~iiG~~~~GKTsl~~~------~~~~~~~~~~~~t~~   35 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIV------FSKDQFPEVYVPTVF   35 (175)
T ss_pred             cEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            6899999999999999998      888888888888877

The RhoA subfamily consists of RhoA, RhoB, and RhoC. RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility. RhoA can bind to multiple effector proteins, thereby triggering different downstream responses. In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis. RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation. RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. RhoA and RhoC are observed only in geranyl

>KOG0081|consensus

Probab=98.96  E-value=3.2e-11  Score=71.90  Aligned_cols=48  Identities=27%  Similarity=0.311  Sum_probs=42.2

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ..+++.+|.+.+||+||||||++.+      |..+.|...+++|+| |||-.+.+
T Consensus         4 GdydylikfLaLGDSGVGKTs~Ly~------YTD~~F~~qFIsTVG-IDFreKrv   51 (219)
T KOG0081|consen    4 GDYDYLIKFLALGDSGVGKTSFLYQ------YTDGKFNTQFISTVG-IDFREKRV   51 (219)
T ss_pred             ccHHHHHHHHhhccCCCCceEEEEE------ecCCcccceeEEEee-cccccceE
Confidence            4567888999999999999999998      999999999999999 88765543

>cd04143 Rhes_like Rhes_like subfamily

Probab=98.95  E-value=7.8e-10  Score=68.67  Aligned_cols=40  Identities=28%  Similarity=0.343  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||||+.+      |..+.|...|.||++  |++...
T Consensus         1 ~KVvvlG~~gvGKTSLi~r------~~~~~f~~~y~pTi~--d~~~k~   40 (247)
T cd04143           1 YRMVVLGASKVGKTAIVSR------FLGGRFEEQYTPTIE--DFHRKL   40 (247)
T ss_pred             CEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCChh--HhEEEE
Confidence            5899999999999999998      888888888999997  666543

This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1). These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization. Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum. Rhes expression is controlled by thyroid hormones. In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane. Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling. Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity. Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l

>cd04103 Centaurin_gamma Centaurin gamma

Probab=98.95  E-value=1.3e-09  Score=63.27  Aligned_cols=32  Identities=22%  Similarity=0.339  Sum_probs=26.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccce
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPT   50 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~t   50 (65)
                      +|++++|++|||||+|+.+      |..+.|...+.|+
T Consensus         1 ~ki~vvG~~gvGKTsli~~------~~~~~f~~~~~~~   32 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHR------YLTGSYVQLESPE   32 (158)
T ss_pred             CEEEEECCCCCcHHHHHHH------HHhCCCCCCCCCC
Confidence            4899999999999999997      7777776666554

The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues.

>cd04135 Tc10 TC10 subfamily

Probab=98.95  E-value=1.8e-09  Score=62.44  Aligned_cols=39  Identities=49%  Similarity=0.778  Sum_probs=33.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.++|||+|+.+      |..+.|...+.||++  +.+..
T Consensus         1 ~ki~i~G~~~~GKTsl~~~------~~~~~~~~~~~~t~~--~~~~~   39 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMS------YANDAFPEEYVPTVF--DHYAV   39 (174)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeEE
Confidence            5899999999999999997      888888888888887  55543

TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro. Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration. TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins. GTP-bound TC10 in vitro can bind numerous potential effectors. Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes. TC10 mRNAs are highly expressed in three types of mouse muscle tissues: leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns. TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti

>cd04101 RabL4 RabL4 (Rab-like4) subfamily

Probab=98.95  E-value=2.5e-09  Score=61.30  Aligned_cols=40  Identities=30%  Similarity=0.358  Sum_probs=32.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccc--cccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLS--QLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~--~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      +..+  .|..+|.||++ .+.+..
T Consensus         1 ~ki~vvG~~~~GKtsl~~~------l~~~~~~~~~~~~~t~~-~~~~~~   42 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQM------FHSNGAVFPKNYLMTTG-CDFVVK   42 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCcCccCCCceE-EEEEEE
Confidence            4899999999999999997      6543  67888999997 455443

RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like. As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus. The specific function of RabL4 remains unknown.

>cd04116 Rab9 Rab9 subfamily

Probab=98.94  E-value=4.1e-09  Score=60.85  Aligned_cols=41  Identities=24%  Similarity=0.382  Sum_probs=34.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ...+|++++|+++||||+|+.+      +..+.|...+.|+++ ++++
T Consensus         3 ~~~~ki~vvG~~~~GKTsli~~------~~~~~~~~~~~~~~~-~~~~   43 (170)
T cd04116           3 SSLLKVILLGDGGVGKSSLMNR------YVTNKFDTQLFHTIG-VEFL   43 (170)
T ss_pred             ceEEEEEEECCCCCCHHHHHHH------HHcCCCCcCcCCcee-eEEE
Confidence            3568999999999999999997      777888887888887 4443

Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47). Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs. Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX

>cd01864 Rab19 Rab19 subfamily

Probab=98.94  E-value=2.7e-09  Score=61.45  Aligned_cols=36  Identities=25%  Similarity=0.325  Sum_probs=30.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+|++++|++|+|||+|+.+      +..+.|...+.++++
T Consensus         2 ~~~kv~vvG~~~~GKTsli~~------l~~~~~~~~~~~t~~   37 (165)
T cd01864           2 FLFKIILIGDSNVGKTCVVQR------FKSGTFSERQGNTIG   37 (165)
T ss_pred             ceeEEEEECCCCCCHHHHHHH------HhhCCCcccCCCccc
Confidence            468999999999999999997      776777777777776

Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd04140 ARHI_like ARHI subfamily

Probab=98.93  E-value=1.9e-09  Score=62.29  Aligned_cols=38  Identities=32%  Similarity=0.521  Sum_probs=32.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +||+++|++|||||+|+.+      +..+.|...+.||++  +.|.
T Consensus         2 ~kv~~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~   39 (165)
T cd04140           2 YRVVVFGAGGVGKSSLVLR------FVKGTFRESYIPTIE--DTYR   39 (165)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCcch--heEE
Confidence            7999999999999999998      888888888888887  5554

ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily

Probab=98.93  E-value=3.3e-09  Score=61.60  Aligned_cols=40  Identities=28%  Similarity=0.390  Sum_probs=33.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+|++++|++|||||+|+.+      +..+.|...+.|+++ .+++.
T Consensus         2 ~~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   41 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYR------FCAGRFPERTEATIG-VDFRE   41 (170)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HHhCCCCCcccccee-EEEEE
Confidence            47999999999999999998      777788877888887 44443

Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily

Probab=98.92  E-value=3e-09  Score=61.22  Aligned_cols=39  Identities=26%  Similarity=0.401  Sum_probs=32.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      .+|++++|+++||||+|+.+      +..+.|...+.||++ .++.
T Consensus         2 ~~ki~i~G~~~vGKSsli~~------~~~~~~~~~~~~t~~-~~~~   40 (166)
T cd01869           2 LFKLLLIGDSGVGKSCLLLR------FADDTYTESYISTIG-VDFK   40 (166)
T ss_pred             eEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc-eeEE
Confidence            48999999999999999997      777778778888887 4443

Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

>cd04106 Rab23_lke Rab23-like subfamily

Probab=98.92  E-value=3.7e-09  Score=60.37  Aligned_cols=38  Identities=26%  Similarity=0.357  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|++++|||||+.+      +..+.|...+.||++ .+..
T Consensus         1 ~kv~~vG~~~~GKTsl~~~------~~~~~~~~~~~~t~~-~~~~   38 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQR------FVKGIFTKDYKKTIG-VDFL   38 (162)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcEE-EEEE
Confidence            4899999999999999997      888888888889987 4543

Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

>smart00173 RAS Ras subfamily of RAS small GTPases

Probab=98.92  E-value=1.6e-09  Score=62.04  Aligned_cols=38  Identities=34%  Similarity=0.492  Sum_probs=31.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      +..+.|...+.||+.  +.+.
T Consensus         1 ~ki~v~G~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~   38 (164)
T smart00173        1 YKLVVLGSGGVGKSALTIQ------FVQGHFVDDYDPTIE--DSYR   38 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCcCCcccCCchh--hhEE
Confidence            5899999999999999997      777777777777776  5554

Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors to protein kinase cascades

>cd04132 Rho4_like Rho4-like subfamily

Probab=98.91  E-value=3.2e-09  Score=62.27  Aligned_cols=38  Identities=42%  Similarity=0.576  Sum_probs=32.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|+.+||||+|+.+      +..+.|...+.||++  +.|.
T Consensus         1 ~ki~vvG~~~vGKTsli~~------l~~~~~~~~~~~t~~--~~~~   38 (187)
T cd04132           1 KKIVVVGDGGCGKTCLLIV------YSQGKFPEEYVPTVF--ENYV   38 (187)
T ss_pred             CeEEEECCCCCCHHHHHHH------HHhCcCCCCCCCeee--eeeE
Confidence            4899999999999999998      888888888899987  5544

Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis. Rho4 also plays a role in cell morphogenesis. Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules. The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP. In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>cd04125 RabA_like RabA-like subfamily

Probab=98.91  E-value=3.9e-09  Score=62.20  Aligned_cols=34  Identities=26%  Similarity=0.423  Sum_probs=30.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+++||||+|+.+      +..+.|...+.||++
T Consensus         1 ~ki~v~G~~~vGKSsli~~------~~~~~~~~~~~~t~~   34 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKR------FTEDEFSESTKSTIG   34 (188)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee
Confidence            5899999999999999998      888888887888887

RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells. The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression. The function of RabA remains unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd04142 RRP22 RRP22 subfamily

Probab=98.90  E-value=2e-09  Score=64.71  Aligned_cols=38  Identities=26%  Similarity=0.413  Sum_probs=31.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +||+++|+++||||||+.+      |..+.|...|.||++ .+.+
T Consensus         1 ~kI~ivG~~~vGKTsLi~~------~~~~~f~~~~~pt~~-~~~~   38 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQ------FLAQEFPEEYIPTEH-RRLY   38 (198)
T ss_pred             CEEEEECCCCCcHHHHHHH------HHcCCCCcccCCccc-cccc
Confidence            5899999999999999998      888888888888886 3443

RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death. Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation. RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Like most Ras family proteins, RRP22 is farnesylated.

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]

Probab=98.89  E-value=4.3e-09  Score=62.96  Aligned_cols=34  Identities=35%  Similarity=0.429  Sum_probs=32.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.|+|||||+.+      +..+.|...+.||++
T Consensus         6 ~kivv~G~~g~GKTtl~~~------l~~~~~~~~~~~t~~   39 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNR------LVGDEFPEGYPPTIG   39 (219)
T ss_pred             EEEEEEcCCCccHHHHHHH------HhcCcCcccCCCcee
Confidence            8999999999999999998      999999999999987

>PLN03108 Rab family protein; Provisional

Probab=98.89  E-value=4.3e-09  Score=63.52  Aligned_cols=40  Identities=28%  Similarity=0.421  Sum_probs=32.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      .+.+||+++|+.++|||+|+.+      +..+.|...+.||++ .++
T Consensus         4 ~~~~kivivG~~gvGKStLi~~------l~~~~~~~~~~~ti~-~~~   43 (210)
T PLN03108          4 AYLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG-VEF   43 (210)
T ss_pred             CcceEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCCcc-ceE
Confidence            3569999999999999999997      777777777778876 344

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily

Probab=98.87  E-value=4.3e-09  Score=60.07  Aligned_cols=40  Identities=38%  Similarity=0.414  Sum_probs=32.7

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|++++|||+|+.+      +..+.+...+.||++  +.+..
T Consensus         2 ~~ki~i~G~~~~GKtsl~~~------~~~~~~~~~~~~t~~--~~~~~   41 (164)
T cd04145           2 TYKLVVVGGGGVGKSALTIQ------FIQSYFVTDYDPTIE--DSYTK   41 (164)
T ss_pred             ceEEEEECCCCCcHHHHHHH------HHhCCCCcccCCCcc--ceEEE
Confidence            47999999999999999997      777777777888877  55443

This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells. It interacts with some of the known Ras effectors, but appears to also have its own effectors. Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts. Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum. In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras. TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali

>cd04124 RabL2 RabL2 subfamily

Probab=98.87  E-value=6.6e-09  Score=59.93  Aligned_cols=34  Identities=29%  Similarity=0.463  Sum_probs=28.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|||||||+.+      +..+.|...+.|+++
T Consensus         1 ~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~~~~   34 (161)
T cd04124           1 VKIILLGDSAVGKSKLVER------FLMDGYEPQQLSTYA   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCcee
Confidence            4899999999999999997      777777777777765

RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b

>KOG0088|consensus

Probab=98.87  E-value=1.3e-09  Score=65.10  Aligned_cols=55  Identities=24%  Similarity=0.303  Sum_probs=42.5

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEE--------EeeEEEEEEecC
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWA--------IDQYRIYKDTLE   65 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~--------vd~~~~~~~i~~   65 (65)
                      ........||++++|+..||||||+.|      |+.+.|...+.+|+-+        ++.-++.+.|||
T Consensus         6 ~~~g~s~~FK~VLLGEGCVGKtSLVLR------y~EnkFn~kHlsTlQASF~~kk~n~ed~ra~L~IWD   68 (218)
T KOG0088|consen    6 NVDGKSFKFKIVLLGEGCVGKTSLVLR------YVENKFNCKHLSTLQASFQNKKVNVEDCRADLHIWD   68 (218)
T ss_pred             cccCCceeeEEEEEcCCccchhHHHHH------HHHhhcchhhHHHHHHHHhhcccccccceeeeeeee
Confidence            344567889999999999999999998      8888888777665431        445666777776

>cd01866 Rab2 Rab2 subfamily

Probab=98.87  E-value=6.9e-09  Score=60.12  Aligned_cols=37  Identities=30%  Similarity=0.426  Sum_probs=31.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+++||||+|+.+      +....+...+.|+++
T Consensus         2 ~~~~ki~vvG~~~vGKSsLl~~------l~~~~~~~~~~~t~~   38 (168)
T cd01866           2 AYLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG   38 (168)
T ss_pred             CcceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            3458999999999999999997      777777777777776

Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur

>cd01868 Rab11_like Rab11-like

Probab=98.86  E-value=7.1e-09  Score=59.52  Aligned_cols=36  Identities=28%  Similarity=0.429  Sum_probs=30.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|...+.|+++
T Consensus         2 ~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   37 (165)
T cd01868           2 YLFKIVLIGDSGVGKSNLLSR------FTRNEFNLDSKSTIG   37 (165)
T ss_pred             CceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            348999999999999999997      777777777778877

Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP

>cd04144 Ras2 Ras2 subfamily

Probab=98.86  E-value=2.4e-09  Score=63.44  Aligned_cols=37  Identities=46%  Similarity=0.663  Sum_probs=31.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      |++++|+.|||||||+.+      |..+.|...+.||++  +.+.
T Consensus         1 ki~ivG~~~vGKTsli~~------l~~~~f~~~~~~t~~--~~~~   37 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQ------LCLNHFVETYDPTIE--DSYR   37 (190)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCccCCCchH--hhEE
Confidence            689999999999999997      777788888888887  5554

The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis. In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family. Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.

>KOG0097|consensus

Probab=98.85  E-value=4.9e-09  Score=61.76  Aligned_cols=47  Identities=17%  Similarity=0.256  Sum_probs=40.1

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +..+.+.||.+++||-|||||||+++      |....|......||| ++|-+.
T Consensus         5 pynysyifkyiiigdmgvgkscllhq------ftekkfmadcphtig-vefgtr   51 (215)
T KOG0097|consen    5 PYNYSYIFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG-VEFGTR   51 (215)
T ss_pred             ccchhheEEEEEEccccccHHHHHHH------HHHHHHhhcCCcccc-eeccee
Confidence            45678899999999999999999998      999889888888888 676543

>cd04177 RSR1 RSR1 subgroup

Probab=98.84  E-value=6.1e-09  Score=60.28  Aligned_cols=39  Identities=33%  Similarity=0.469  Sum_probs=33.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      +..+.|...+.||++  +.+..
T Consensus         2 ~ki~liG~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~~   40 (168)
T cd04177           2 YKIVVLGAGGVGKSALTVQ------FVQNVFIESYDPTIE--DSYRK   40 (168)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCcch--heEEE
Confidence            7999999999999999998      888888888888887  55543

RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

>cd04113 Rab4 Rab4 subfamily

Probab=98.83  E-value=9.6e-09  Score=58.75  Aligned_cols=34  Identities=18%  Similarity=0.317  Sum_probs=28.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+++||||+|+.+      +..+.+...+.|+++
T Consensus         1 ~ki~v~G~~~vGKTsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd04113           1 FKFIIIGSSGTGKSCLLHR------FVENKFKEDSQHTIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee
Confidence            5899999999999999997      777777777777766

Rab4 has been implicated in numerous functions within the cell. It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A. Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane. It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p

>cd04118 Rab24 Rab24 subfamily

Probab=98.83  E-value=9.1e-09  Score=60.70  Aligned_cols=34  Identities=32%  Similarity=0.402  Sum_probs=29.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccc-cccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLT-THVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~-~~~~ti~   52 (65)
                      +||+++|+++||||||+.+      +..+.|.. .|.||++
T Consensus         1 ~ki~vvG~~~vGKSsLi~~------~~~~~~~~~~~~~t~~   35 (193)
T cd04118           1 VKVVMLGKESVGKTSLVER------YVHHRFLVGPYQNTIG   35 (193)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCcCCcCccccee
Confidence            4899999999999999997      77777764 6888887

Rab24 is distinct from other Rabs in several ways. It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments. It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita

>cd04126 Rab20 Rab20 subfamily

Probab=98.82  E-value=7.7e-09  Score=63.39  Aligned_cols=45  Identities=29%  Similarity=0.298  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE-----EEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR-----IYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~-----~~~~i~~   65 (65)
                      +|++++|+.+||||+|+.+      |..+.|.. +.||++ .+++.     ..+.+||
T Consensus         1 ~KIvivG~~~vGKTSLi~r------~~~~~f~~-~~~Tig-~~~~~~~~~~~~l~iwD   50 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHR------YMERRFKD-TVSTVG-GAFYLKQWGPYNISIWD   50 (220)
T ss_pred             CEEEEECCCCCcHHHHHHH------HhcCCCCC-CCCccc-eEEEEEEeeEEEEEEEe
Confidence            5899999999999999998      87777765 578887 35443     3355665

Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells. It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells. Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron. It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo

>cd04148 RGK RGK subfamily

Probab=98.81  E-value=6.4e-09  Score=63.37  Aligned_cols=34  Identities=18%  Similarity=0.196  Sum_probs=27.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +||+++|++|||||+|+.+      |..+.|. ..|.|+++
T Consensus         1 ~KI~lvG~~gvGKTsLi~~------~~~~~~~~~~~~~t~~   35 (221)
T cd04148           1 YRVVMLGSPGVGKSSLASQ------FTSGEYDDHAYDASGD   35 (221)
T ss_pred             CEEEEECCCCCcHHHHHHH------HhcCCcCccCcCCCcc
Confidence            5899999999999999997      7666665 56666664

The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues. RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function. Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells. RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton. Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases

Probab=98.81  E-value=8.2e-09  Score=59.70  Aligned_cols=38  Identities=42%  Similarity=0.586  Sum_probs=31.8

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      |+++|++|||||+|+.+      |..+.|...|.|+++  +.|...
T Consensus         1 i~i~G~~~vGKTsli~~------~~~~~~~~~~~~~~~--~~~~~~   38 (174)
T smart00174        1 LVVVGDGAVGKTCLLIS------YTTNAFPEDYVPTVF--ENYSAD   38 (174)
T ss_pred             CEEECCCCCCHHHHHHH------HHhCCCCCCCCCcEE--eeeeEE
Confidence            57899999999999998      888888888888887  666543

Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily

Probab=98.79  E-value=7.3e-09  Score=59.85  Aligned_cols=33  Identities=30%  Similarity=0.596  Sum_probs=27.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.+||||||+.+      +..+.|. .+.||++
T Consensus         1 ~kv~~~G~~~~GKTsli~~------l~~~~~~-~~~pt~g   33 (159)
T cd04150           1 MRILMVGLDAAGKTTILYK------LKLGEIV-TTIPTIG   33 (159)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCc-ccCCCCC
Confidence            4899999999999999997      7666666 3678876

This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily

Probab=98.77  E-value=6.2e-09  Score=60.48  Aligned_cols=32  Identities=34%  Similarity=0.441  Sum_probs=28.1

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ++++|+.|||||+|+.+      |..+.|...+.||++
T Consensus         2 i~ivG~~~vGKTsli~~------~~~~~~~~~~~pt~g   33 (164)
T cd04162           2 ILVLGLDGAGKTSLLHS------LSSERSLESVVPTTG   33 (164)
T ss_pred             EEEECCCCCCHHHHHHH------HhcCCCcccccccCC
Confidence            68999999999999998      777777788888876

Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project. It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2). This is a novel subfamily identified in human cancers that is uncharacterized to date.

>cd01862 Rab7 Rab7 subfamily

Probab=98.77  E-value=1.9e-08  Score=57.79  Aligned_cols=34  Identities=26%  Similarity=0.405  Sum_probs=28.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +||+++|++++|||||+.+      +....+...+.++++
T Consensus         1 ~ki~viG~~~~GKSsl~~~------l~~~~~~~~~~~t~~   34 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQ------YVNKKFSNQYKATIG   34 (172)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCcCcCCccc
Confidence            5899999999999999997      766667776777766

Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway. The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion. Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-

>cd01860 Rab5_related Rab5-related subfamily

Probab=98.77  E-value=2e-08  Score=57.33  Aligned_cols=35  Identities=26%  Similarity=0.399  Sum_probs=29.3

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++++|||+|+.+      +..+.+...+.|+.+
T Consensus         1 ~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   35 (163)
T cd01860           1 QFKLVLLGDSSVGKSSLVLR------FVKNEFSENQESTIG   35 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            37999999999999999997      777777766777776

This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways. In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo

>PTZ00133 ADP-ribosylation factor; Provisional

Probab=98.77  E-value=9.2e-09  Score=60.83  Aligned_cols=35  Identities=31%  Similarity=0.555  Sum_probs=28.7

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|.. +.||++
T Consensus        16 ~~~kv~lvG~~~vGKTsli~~------~~~~~~~~-~~~T~~   50 (182)
T PTZ00133         16 KEVRILMVGLDAAGKTTILYK------LKLGEVVT-TIPTIG   50 (182)
T ss_pred             CccEEEEEcCCCCCHHHHHHH------HhcCCccc-cCCccc
Confidence            358999999999999999997      66666654 678877

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily

Probab=98.76  E-value=5.4e-09  Score=60.19  Aligned_cols=33  Identities=24%  Similarity=0.392  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|++|||||+|+.+      +..+.|...|.|+..
T Consensus         1 ki~vvG~~~~GKtsli~~------~~~~~~~~~~~~t~~   33 (165)
T cd04146           1 KIAVLGASGVGKSALVVR------FLTKRFIGEYDPNLE   33 (165)
T ss_pred             CEEEECCCCCcHHHHHHH------HHhCccccccCCChH
Confidence            689999999999999997      666666666666653

RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively. RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis. Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression. In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo. RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors. Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm. Both are believed to have tu

>cd04112 Rab26 Rab26 subfamily

Probab=98.76  E-value=1.4e-08  Score=60.20  Aligned_cols=34  Identities=32%  Similarity=0.476  Sum_probs=27.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +|++++|+.+||||||+.+      +..+.|. ..+.||++
T Consensus         1 ~Ki~vvG~~~vGKTSli~~------~~~~~~~~~~~~~t~~   35 (191)
T cd04112           1 FKVMLLGDSGVGKTCLLVR------FKDGAFLNGNFIATVG   35 (191)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCccCcCCccc
Confidence            5899999999999999997      6666664 35666665

First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation. Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor

Probab=98.76  E-value=1.4e-08  Score=59.47  Aligned_cols=35  Identities=29%  Similarity=0.501  Sum_probs=28.9

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+.+||||+|+.+      +..+.|. .+.||++
T Consensus        12 ~~~ki~l~G~~~~GKTsL~~~------~~~~~~~-~~~~t~~   46 (175)
T smart00177       12 KEMRILMVGLDAAGKTTILYK------LKLGESV-TTIPTIG   46 (175)
T ss_pred             CccEEEEEcCCCCCHHHHHHH------HhcCCCC-CcCCccc
Confidence            458999999999999999997      7666664 4678887

Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).

>cd04139 RalA_RalB RalA/RalB subfamily

Probab=98.75  E-value=1.4e-08  Score=57.83  Aligned_cols=34  Identities=29%  Similarity=0.382  Sum_probs=28.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|+|||||+.+      +..+.|...+.|+++
T Consensus         1 ~ki~~~G~~~~GKTsl~~~------l~~~~~~~~~~~~~~   34 (164)
T cd04139           1 YKVIVVGAGGVGKSALTLQ------FMYDEFVEDYEPTKA   34 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCccccCCcch
Confidence            5899999999999999997      777777777777765

The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB. Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics. Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration. In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it. A Ral-specific set of GEFs has been identified that are activated by Ras binding. This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K). Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis. In rat kidney cells, RalB is required for functional assembly of the exo

>KOG4252|consensus

Probab=98.74  E-value=2.3e-09  Score=65.04  Aligned_cols=50  Identities=22%  Similarity=0.253  Sum_probs=43.4

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEec
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTL   64 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i~   64 (65)
                      .....+|++++|..+|||+++++|      |+.+-|...|.-||| +|+...+..|+
T Consensus        16 d~e~aiK~vivGng~VGKssmiqr------yCkgifTkdykktIg-vdflerqi~v~   65 (246)
T KOG4252|consen   16 DYERAIKFVIVGNGSVGKSSMIQR------YCKGIFTKDYKKTIG-VDFLERQIKVL   65 (246)
T ss_pred             hhhhhEEEEEECCCccchHHHHHH------Hhccccccccccccc-hhhhhHHHHhh
Confidence            446679999999999999999998      999999999999999 88877665543

>cd04129 Rho2 Rho2 subfamily

Probab=98.74  E-value=2.1e-08  Score=59.25  Aligned_cols=38  Identities=39%  Similarity=0.620  Sum_probs=30.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|++|+|||+|+.+      +..+.|...+.||++  +.+.
T Consensus         2 ~Ki~ivG~~g~GKStLl~~------l~~~~~~~~~~~t~~--~~~~   39 (187)
T cd04129           2 RKLVIVGDGACGKTSLLSV------FTLGEFPEEYHPTVF--ENYV   39 (187)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCccc--ceEE
Confidence            5999999999999999997      766677777777776  5444

Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction. Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase. Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall. Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for proper intracellular localization via membrane attachment. As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).

>cd00157 Rho Rho (Ras homology) family

Probab=98.74  E-value=2.7e-08  Score=57.07  Aligned_cols=40  Identities=48%  Similarity=0.667  Sum_probs=31.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|+|||+|+.+      +..+.+...+.|++.  +.+...
T Consensus         1 iki~i~G~~~~GKSsli~~------l~~~~~~~~~~~~~~--~~~~~~   40 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLIS------YTTGKFPTEYVPTVF--DNYSAT   40 (171)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeEEE
Confidence            5899999999999999997      777777666777776  544433

Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop. There are 22 human Rho family members identified currently. These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli. They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase. These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho protein

>cd04114 Rab30 Rab30 subfamily

Probab=98.73  E-value=5.2e-08  Score=55.99  Aligned_cols=41  Identities=27%  Similarity=0.339  Sum_probs=31.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ...+|++++|++|||||+|+.+      +..+.+...+.++++ .++.
T Consensus         5 ~~~~~v~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~~   45 (169)
T cd04114           5 DFLFKIVLIGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFM   45 (169)
T ss_pred             CceeEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee-eEEE
Confidence            3568999999999999999997      666666666777776 3443

Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd01861 Rab6 Rab6 subfamily

Probab=98.73  E-value=3.1e-08  Score=56.45  Aligned_cols=34  Identities=29%  Similarity=0.340  Sum_probs=27.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++++|||+|+.+      +....+...+.|+.+
T Consensus         1 ~ki~liG~~~~GKSsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd01861           1 HKLVFLGDQSVGKTSIITR------FMYDTFDNQYQATIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCccCCCcee
Confidence            4899999999999999997      666666666667665

Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate

>PLN03118 Rab family protein; Provisional

Probab=98.73  E-value=3.9e-08  Score=59.10  Aligned_cols=40  Identities=25%  Similarity=0.375  Sum_probs=30.6

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +......+|++++|++|||||+|+.+      +..+.+ ..+.|+++
T Consensus         8 ~~~~~~~~kv~ivG~~~vGKTsli~~------l~~~~~-~~~~~t~~   47 (211)
T PLN03118          8 SSGYDLSFKILLIGDSGVGKSSLLVS------FISSSV-EDLAPTIG   47 (211)
T ss_pred             ccccCcceEEEEECcCCCCHHHHHHH------HHhCCC-CCcCCCce
Confidence            34556679999999999999999997      655554 34567766

>smart00175 RAB Rab subfamily of small GTPases

Probab=98.72  E-value=4e-08  Score=55.96  Aligned_cols=34  Identities=24%  Similarity=0.410  Sum_probs=28.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++++|||+|+.+      +....+...+.++++
T Consensus         1 ~kv~v~G~~~~GKTtli~~------l~~~~~~~~~~~~~~   34 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSR------FTDGKFSEQYKSTIG   34 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee
Confidence            5899999999999999997      766666766777776

Rab GTPases are implicated in vesicle trafficking.

>TIGR02528 EutP ethanolamine utilization protein, EutP

Probab=98.71  E-value=1.9e-08  Score=56.61  Aligned_cols=36  Identities=19%  Similarity=0.241  Sum_probs=27.5

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      |++++|+++||||||+.+      +....+  .+.+|++ +++..
T Consensus         2 kv~liG~~~vGKSsL~~~------l~~~~~--~~~~t~~-~~~~~   37 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQA------LQGEEI--LYKKTQA-VEYND   37 (142)
T ss_pred             eEEEECCCCCCHHHHHHH------HcCCcc--cccccee-EEEcC
Confidence            899999999999999997      655544  3567776 45543

This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.

>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily

Probab=98.71  E-value=9.4e-09  Score=56.30  Aligned_cols=34  Identities=24%  Similarity=0.152  Sum_probs=27.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccccccc-ceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHV-PTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~-~ti~   52 (65)
                      +|++++|++|||||+|+.|      |..+.|...+. +|++
T Consensus         1 ~kvv~~G~~gvGKt~l~~~------~~~~~~~~~~~~~t~~   35 (124)
T smart00010        1 FKVVGIGDSGVGKVGKSAR------FVQFPFDYVPTVFTIG   35 (124)
T ss_pred             CEEEEECCCChhHHHHHHH------HhcCCccccCceehhh
Confidence            5899999999999999998      87777765554 5543

SMART predicts Ras-like small GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies. Others that could not be classified in this way are predicted to be members of the small GTPase superfamily without predictions of the subfamily.

>cd04147 Ras_dva Ras-dva subfamily

Probab=98.71  E-value=1.4e-08  Score=60.60  Aligned_cols=33  Identities=30%  Similarity=0.286  Sum_probs=28.1

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ||+++|+.|||||+|+.+      +..+.|...+.+|+.
T Consensus         1 kv~vvG~~~vGKTsll~~------~~~~~~~~~~~~t~~   33 (198)
T cd04147           1 RLVFMGAAGVGKTALIQR------FLYDTFEPKYRRTVE   33 (198)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCccCCCchh
Confidence            689999999999999997      777777777777765

Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date. In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm. Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1. Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9. Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.

>cd04149 Arf6 Arf6 subfamily

Probab=98.70  E-value=2.5e-08  Score=58.20  Aligned_cols=35  Identities=31%  Similarity=0.498  Sum_probs=28.1

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||||+.+      +..+.+. .+.||++
T Consensus         8 ~~~kv~i~G~~~~GKTsli~~------l~~~~~~-~~~~t~g   42 (168)
T cd04149           8 KEMRILMLGLDAAGKTTILYK------LKLGQSV-TTIPTVG   42 (168)
T ss_pred             CccEEEEECcCCCCHHHHHHH------HccCCCc-cccCCcc
Confidence            458999999999999999997      6655554 3567776

Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t

>PLN00223 ADP-ribosylation factor; Provisional

Probab=98.68  E-value=2.8e-08  Score=58.81  Aligned_cols=35  Identities=29%  Similarity=0.547  Sum_probs=29.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|. .+.||++
T Consensus        16 ~~~ki~ivG~~~~GKTsl~~~------l~~~~~~-~~~pt~g   50 (181)
T PLN00223         16 KEMRILMVGLDAAGKTTILYK------LKLGEIV-TTIPTIG   50 (181)
T ss_pred             CccEEEEECCCCCCHHHHHHH------HccCCCc-cccCCcc
Confidence            358999999999999999997      7666665 4678887

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily

Probab=98.65  E-value=4.3e-08  Score=57.10  Aligned_cols=34  Identities=26%  Similarity=0.391  Sum_probs=28.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .|++++|++|||||+|+.+      +....+...+.||+.
T Consensus         2 ~kv~l~G~~g~GKTtl~~~------~~~~~~~~~~~~t~~   35 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQ------FVEGHFVESYYPTIE   35 (180)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCccccCcchh
Confidence            6899999999999999997      776777666777664

Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

>cd00154 Rab Rab family

Probab=98.63  E-value=1e-07  Score=53.39  Aligned_cols=34  Identities=29%  Similarity=0.369  Sum_probs=28.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.++|||||+.+      +....+...+.+|.+
T Consensus         1 ~~i~~~G~~~~GKStl~~~------l~~~~~~~~~~~t~~   34 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLR------FVDGKFDENYKSTIG   34 (159)
T ss_pred             CeEEEECCCCCCHHHHHHH------HHhCcCCCccCCcee
Confidence            4899999999999999997      777777766667766

Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di

>cd04158 ARD1 ARD1 subfamily

Probab=98.63  E-value=5.2e-08  Score=56.62  Aligned_cols=32  Identities=22%  Similarity=0.481  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.+||||+|+.+      +..+.+.. +.||++
T Consensus         1 ~vvlvG~~~~GKTsl~~~------l~~~~~~~-~~~T~~   32 (169)
T cd04158           1 RVVTLGLDGAGKTTILFK------LKQDEFMQ-PIPTIG   32 (169)
T ss_pred             CEEEECCCCCCHHHHHHH------HhcCCCCC-cCCcCc
Confidence            689999999999999997      66666654 678876

ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily

Probab=98.62  E-value=5.9e-08  Score=57.24  Aligned_cols=34  Identities=26%  Similarity=0.457  Sum_probs=27.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++|||||||+.+      +..+.|... .||++
T Consensus         3 ~~kv~~vG~~~~GKTsli~~------~~~~~~~~~-~~t~~   36 (183)
T cd04152           3 SLHIVMLGLDSAGKTTVLYR------LKFNEFVNT-VPTKG   36 (183)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCcCCc-CCccc
Confidence            58999999999999999997      666666543 56665

Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus. In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed. Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages. Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.

>cd01863 Rab18 Rab18 subfamily

Probab=98.62  E-value=8.1e-08  Score=54.80  Aligned_cols=34  Identities=24%  Similarity=0.387  Sum_probs=28.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.++|||+|+.+      +....+...+.|+++
T Consensus         1 ~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLR------FTDDTFDPDLAATIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCcccCCccc
Confidence            5899999999999999997      666666666677776

Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos

>cd04159 Arl10_like Arl10-like subfamily

Probab=98.61  E-value=5.4e-08  Score=54.59  Aligned_cols=32  Identities=31%  Similarity=0.396  Sum_probs=27.7

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.++|++|+|||||+.+      +....|...+.||++
T Consensus         2 i~i~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   33 (159)
T cd04159           2 ITLVGLQNSGKTTLVNV------IAGGQFSEDTIPTVG   33 (159)
T ss_pred             EEEEcCCCCCHHHHHHH------HccCCCCcCccCCCC
Confidence            68999999999999997      777777777888876

Arl9/Arl10 was identified from a human cancer-derived EST dataset. No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.

>cd01893 Miro1 Miro1 subfamily

Probab=98.61  E-value=6.2e-08  Score=56.00  Aligned_cols=28  Identities=29%  Similarity=0.513  Sum_probs=22.9

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccc
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTH   47 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~   47 (65)
                      |++++|+++||||+|+.+      +..+.|...+
T Consensus         2 kv~ivG~~~vGKTsl~~~------l~~~~~~~~~   29 (166)
T cd01893           2 RIVLIGDEGVGKSSLIMS------LVSEEFPENV   29 (166)
T ss_pred             EEEEECCCCCCHHHHHHH------HHhCcCCccC
Confidence            899999999999999997      6666665443

Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the N-terminal GTPase domain of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.

>cd04157 Arl6 Arl6 subfamily

Probab=98.58  E-value=7.4e-08  Score=54.85  Aligned_cols=33  Identities=33%  Similarity=0.339  Sum_probs=26.6

Q ss_pred             EEEEECCCCChHHHHHhHhhhcccccccc-ccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQ-LLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~-~~~~~~~ti~   52 (65)
                      +|+++|+++||||+|+.+      +.... +...+.||++
T Consensus         1 ~i~~vG~~~~GKTsl~~~------l~~~~~~~~~~~~t~g   34 (162)
T cd04157           1 NILVVGLDNSGKTTIINQ------LKPENAQSQIIVPTVG   34 (162)
T ss_pred             CEEEECCCCCCHHHHHHH------HcccCCCcceecCccc
Confidence            478999999999999997      66654 4566778876

Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases

Probab=98.57  E-value=9.2e-08  Score=57.81  Aligned_cols=35  Identities=23%  Similarity=0.285  Sum_probs=29.9

Q ss_pred             ECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         18 VGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        18 lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|+.|||||||+.|      |..+.|...|.||++ +++++.
T Consensus         1 vG~~~vGKTsLi~r------~~~~~f~~~~~~Tig-~~~~~~   35 (200)
T smart00176        1 VGDGGTGKTTFVKR------HLTGEFEKKYVATLG-VEVHPL   35 (200)
T ss_pred             CCCCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEE
Confidence            59999999999998      888889888999998 566544

Ran is involved in the active transport of proteins through nuclear pores.

>cd00876 Ras Ras family

Probab=98.56  E-value=8.8e-08  Score=54.16  Aligned_cols=33  Identities=27%  Similarity=0.378  Sum_probs=25.4

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.++|||+|+.+      +....+...+.|+..
T Consensus         1 ki~i~G~~~~GKTsli~~------l~~~~~~~~~~~~~~   33 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQ------FVKGTFVEEYDPTIE   33 (160)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCcCcCCChh
Confidence            689999999999999997      555556555655554

The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins. Ras proteins regulate cell growth, proliferation and differentiation. Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding. Many RasGEFs have been identified. These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of m

>cd04123 Rab21 Rab21 subfamily

Probab=98.55  E-value=1.9e-07  Score=52.84  Aligned_cols=34  Identities=29%  Similarity=0.386  Sum_probs=26.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|+|||+|+.+      +..+.+...+.+++.
T Consensus         1 ~ki~i~G~~~~GKStli~~------l~~~~~~~~~~~~~~   34 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLR------YVENKFNEKHESTTQ   34 (162)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCccc
Confidence            5899999999999999997      666656555555553

The localization and function of Rab21 are not clearly defined, with conflicting data reported. Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker. More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases

Probab=98.51  E-value=2.6e-07  Score=50.59  Aligned_cols=18  Identities=61%  Similarity=0.828  Sum_probs=17.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ||+++|+.|+|||+|+.+
T Consensus         1 kI~V~G~~g~GKTsLi~~   18 (119)
T PF08477_consen    1 KIVVLGDSGVGKTSLIRR   18 (119)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             CEEEECcCCCCHHHHHHH
Confidence            799999999999999996

They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.

>cd04154 Arl2 Arl2 subfamily

Probab=98.50  E-value=2.1e-07  Score=54.06  Aligned_cols=37  Identities=19%  Similarity=0.300  Sum_probs=27.7

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|++++|||+|+.+      +....+ ..+.||++
T Consensus        11 ~~~~~kv~ivG~~~~GKTsL~~~------l~~~~~-~~~~~t~g   47 (173)
T cd04154          11 KEREMRILILGLDNAGKTTILKK------LLGEDI-DTISPTLG   47 (173)
T ss_pred             CCCccEEEEECCCCCCHHHHHHH------HccCCC-CCcCCccc
Confidence            34568999999999999999997      554433 35667765

Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

>cd04155 Arl3 Arl3 subfamily

Probab=98.49  E-value=1.1e-07  Score=54.96  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|++|+|||+|+.+
T Consensus        12 ~~~~~v~i~G~~g~GKStLl~~   33 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQ   33 (173)
T ss_pred             CCccEEEEEccCCCCHHHHHHH
Confidence            3468999999999999999986

Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily

Probab=98.48  E-value=1.6e-07  Score=54.61  Aligned_cols=32  Identities=31%  Similarity=0.355  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++++|+++||||+|+.+      +... +...+.||++
T Consensus         1 ~i~~~G~~~~GKTsl~~~------l~~~-~~~~~~~t~g   32 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSA------LQGE-IPKKVAPTVG   32 (167)
T ss_pred             CEEEECCCCCCHHHHHHH------HhCC-CCccccCccc
Confidence            478999999999999986      5544 6677888887

Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases. Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS). Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions. Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.

>TIGR00231 small_GTP small GTP-binding protein domain

Probab=98.48  E-value=4.7e-07  Score=50.23  Aligned_cols=34  Identities=32%  Similarity=0.482  Sum_probs=26.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +||+++|++|+|||+|+.+      +....+...+.++++
T Consensus         2 ~ki~~~G~~~~GKstl~~~------l~~~~~~~~~~~~~~   35 (161)
T TIGR00231         2 IKIVIVGDPNVGKSTLLNR------LLGNKFITEYKPGTT   35 (161)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhCCCCcCcCCCCce
Confidence            6999999999999999997      555556555655554

This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.

>cd04151 Arl1 Arl1 subfamily

Probab=98.46  E-value=2.2e-07  Score=53.15  Aligned_cols=32  Identities=25%  Similarity=0.558  Sum_probs=24.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.++|||+|+.+      +..+.+.. +.||++
T Consensus         1 kv~lvG~~~~GKTsl~~~------l~~~~~~~-~~~t~~   32 (158)
T cd04151           1 RILILGLDNAGKTTILYR------LQLGEVVT-TIPTIG   32 (158)
T ss_pred             CEEEECCCCCCHHHHHHH------HccCCCcC-cCCccC
Confidence            689999999999999997      55444443 456665

Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network. Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting. In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors. Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding. Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2. Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi. In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases

Probab=98.43  E-value=4.8e-07  Score=53.46  Aligned_cols=22  Identities=27%  Similarity=0.383  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|++|+||||++.+
T Consensus        15 ~~~~~i~ivG~~~~GKTsli~~   36 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHM   36 (184)
T ss_pred             cccCEEEEECCCCCCHHHHHHH
Confidence            3458999999999999999996

Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.

>PRK04213 GTP-binding protein; Provisional

Probab=98.39  E-value=1.1e-06  Score=52.07  Aligned_cols=34  Identities=24%  Similarity=0.359  Sum_probs=25.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVP   49 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~   49 (65)
                      ...++++++|+++||||||+.+      +....+...+.|
T Consensus         7 ~~~~~i~i~G~~~~GKSsLin~------l~~~~~~~~~~~   40 (201)
T PRK04213          7 DRKPEIVFVGRSNVGKSTLVRE------LTGKKVRVGKRP   40 (201)
T ss_pred             CCCCEEEEECCCCCCHHHHHHH------HhCCCCccCCCC
Confidence            3457999999999999999996      554444443444

>cd04160 Arfrp1 Arfrp1 subfamily

Probab=98.38  E-value=5.7e-07  Score=51.55  Aligned_cols=38  Identities=18%  Similarity=0.114  Sum_probs=24.4

Q ss_pred             EEEEECCCCChHHHHHhHhhhcccc-ccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQV-SLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~-~~~~~~~~~~~ti~   52 (65)
                      +++++|+.|+|||+|+.+ ++.... ....+...+.||++
T Consensus         1 ~i~~vG~~~~GKstLi~~-l~~~~~~~~~~~~~~~~~t~~   39 (167)
T cd04160           1 SVLILGLDNAGKTTFLEQ-LKTLFSKYKGLPPSKITPTVG   39 (167)
T ss_pred             CEEEEecCCCCHHHHHHH-HhhhcccccCCcccccCCccc
Confidence            578999999999999986 222111 11233445667765

Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.

>cd04156 ARLTS1 ARLTS1 subfamily

Probab=98.38  E-value=4.9e-07  Score=51.49  Aligned_cols=32  Identities=28%  Similarity=0.533  Sum_probs=24.6

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++++|++|||||+|+.+      +..+.+.. +.||++
T Consensus         1 ~i~i~G~~~~GKTsl~~~------~~~~~~~~-~~~t~~   32 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYK------LKHAELVT-TIPTVG   32 (160)
T ss_pred             CEEEEcCCCCCHHHHHHH------HhcCCccc-ccCccC
Confidence            588999999999999997      66665543 356664

ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling. ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers. ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL). ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter. In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity. In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation. The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h

>PRK00454 engB GTP-binding protein YsxC; Reviewed

Probab=98.36  E-value=7.3e-07  Score=52.43  Aligned_cols=24  Identities=33%  Similarity=0.486  Sum_probs=21.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+...+++++|++|+|||||+.+
T Consensus        20 ~~~~~~~v~ivG~~~~GKSsli~~   43 (196)
T PRK00454         20 PPDDGPEIAFAGRSNVGKSSLINA   43 (196)
T ss_pred             CCCCCCEEEEEcCCCCCHHHHHHH
Confidence            445678999999999999999996

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily

Probab=98.34  E-value=6.4e-07  Score=52.29  Aligned_cols=34  Identities=26%  Similarity=0.428  Sum_probs=27.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++++|||+|+.+      +..+.+.. +.||++
T Consensus        15 ~~kv~~~G~~~~GKTsl~~~------l~~~~~~~-~~~t~~   48 (174)
T cd04153          15 EYKVIIVGLDNAGKTTILYQ------FLLGEVVH-TSPTIG   48 (174)
T ss_pred             ccEEEEECCCCCCHHHHHHH------HccCCCCC-cCCccc
Confidence            57999999999999999997      66555554 467776

Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.

>cd00879 Sar1 Sar1 subfamily

Probab=98.33  E-value=4.2e-07  Score=53.37  Aligned_cols=36  Identities=31%  Similarity=0.441  Sum_probs=26.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|+|||||+.+      +..+.+. .+.||++
T Consensus        17 ~~~~ki~ilG~~~~GKStLi~~------l~~~~~~-~~~~T~~   52 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHM------LKDDRLA-QHVPTLH   52 (190)
T ss_pred             cCCCEEEEECCCCCCHHHHHHH------HhcCCCc-ccCCccC
Confidence            3468999999999999999996      5544442 3445543

Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER. The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER. Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12. Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification. Instead, Sar1 contains a unique nine-amino-acid N-terminal extension. This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif. The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.

>KOG0096|consensus

Probab=98.31  E-value=8.3e-07  Score=54.11  Aligned_cols=42  Identities=24%  Similarity=0.209  Sum_probs=37.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      -..+|++++||.|.|||+...|      ...++|...|.||+| ++.+.
T Consensus         8 ~~~fklvlvGdgg~gKtt~vkr------~ltgeFe~~y~at~G-v~~~p   49 (216)
T KOG0096|consen    8 GLTFKLVLVGDGGTGKTTFVKR------HLTGEFEKTYPATLG-VEVHP   49 (216)
T ss_pred             cceEEEEEecCCcccccchhhh------hhcccceecccCcce-eEEee
Confidence            4679999999999999999998      999999999999999 66554

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases

Probab=98.30  E-value=9.3e-07  Score=50.32  Aligned_cols=32  Identities=25%  Similarity=0.549  Sum_probs=23.5

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.|+|||||+.+      +..+. ...+.||++
T Consensus         1 ki~iiG~~~~GKssli~~------~~~~~-~~~~~~t~~   32 (158)
T cd00878           1 RILILGLDGAGKTTILYK------LKLGE-VVTTIPTIG   32 (158)
T ss_pred             CEEEEcCCCCCHHHHHHH------HhcCC-CCCCCCCcC
Confidence            689999999999999996      54443 233455555

Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thu

>cd01878 HflX HflX subfamily

Probab=98.22  E-value=2.8e-06  Score=50.54  Aligned_cols=21  Identities=33%  Similarity=0.452  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|++|||||||+.+
T Consensus        40 ~~~~I~iiG~~g~GKStLl~~   60 (204)
T cd01878          40 GIPTVALVGYTNAGKSTLFNA   60 (204)
T ss_pred             CCCeEEEECCCCCCHHHHHHH
Confidence            357999999999999999985

A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms.

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB

Probab=98.21  E-value=2.6e-06  Score=49.97  Aligned_cols=23  Identities=30%  Similarity=0.397  Sum_probs=20.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+++++|++|+|||||+.+
T Consensus        15 ~~~~~~i~ivG~~~~GKStlin~   37 (179)
T TIGR03598        15 PDDGPEIAFAGRSNVGKSSLINA   37 (179)
T ss_pred             CCCCCEEEEEcCCCCCHHHHHHH
Confidence            35678999999999999999996

Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)

Probab=98.19  E-value=3.8e-06  Score=50.66  Aligned_cols=31  Identities=19%  Similarity=0.334  Sum_probs=24.2

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccce
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPT   50 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~t   50 (65)
                      .++++|++++|||+|+.+      +..+.+...+.++
T Consensus         2 ~vll~G~~~sGKTsL~~~------l~~~~~~~t~~s~   32 (203)
T cd04105           2 TVLLLGPSDSGKTALFTK------LTTGKYRSTVTSI   32 (203)
T ss_pred             eEEEEcCCCCCHHHHHHH------HhcCCCCCccCcE
Confidence            589999999999999997      6666665555444

SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane. Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP. SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane. The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane. SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon. High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ

>KOG0083|consensus

Probab=98.14  E-value=3.6e-07  Score=53.47  Aligned_cols=33  Identities=33%  Similarity=0.459  Sum_probs=28.1

Q ss_pred             EECCCCChHHHHHhHhhhcccccccccc-ccccceEEEEee
Q psy15257         17 VVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVWAIDQ   56 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~~vd~   56 (65)
                      ++||+++|||||+.|      |..+.|. .++.+|+| ||+
T Consensus         2 llgds~~gktcllir------~kdgafl~~~fistvg-id~   35 (192)
T KOG0083|consen    2 LLGDSCTGKTCLLIR------FKDGAFLAGNFISTVG-IDF   35 (192)
T ss_pred             ccccCccCceEEEEE------eccCceecCceeeeee-ecc
Confidence            689999999999998      8888876 57889998 554

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases

Probab=98.13  E-value=3.2e-06  Score=49.78  Aligned_cols=36  Identities=22%  Similarity=0.409  Sum_probs=27.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....||+++|..++|||+++.+      +..+.+.. ..||+|
T Consensus        12 ~~~~~ililGl~~sGKTtll~~------l~~~~~~~-~~pT~g   47 (175)
T PF00025_consen   12 KKEIKILILGLDGSGKTTLLNR------LKNGEISE-TIPTIG   47 (175)
T ss_dssp             TSEEEEEEEESTTSSHHHHHHH------HHSSSEEE-EEEESS
T ss_pred             CcEEEEEEECCCccchHHHHHH------hhhccccc-cCcccc
Confidence            5678999999999999999996      55444333 667765

This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including: Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other. The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans

Probab=98.11  E-value=9.2e-06  Score=46.53  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=17.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++++|||||+.+
T Consensus         2 ~i~~~G~~~~GKssli~~   19 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNK   19 (168)
T ss_pred             eEEEEcCCCCCHHHHHHH
Confidence            789999999999999996

NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.

>KOG1673|consensus

Probab=98.08  E-value=1.9e-06  Score=51.52  Aligned_cols=49  Identities=16%  Similarity=0.160  Sum_probs=40.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .....+|+-++||..+|||+++.+      |..+++..++.-+.| +.+..+++.|
T Consensus        16 ~n~Vslkv~llGD~qiGKTs~mvk------YV~~~~de~~~q~~G-vN~mdkt~~i   64 (205)
T KOG1673|consen   16 SNLVSLKVGLLGDAQIGKTSLMVK------YVQNEYDEEYTQTLG-VNFMDKTVSI   64 (205)
T ss_pred             ccceEEEEEeecccccCceeeehh------hhcchhHHHHHHHhC-ccceeeEEEe
Confidence            445679999999999999999999      999988888888887 6666655543

>cd01850 CDC_Septin CDC/Septin

Probab=98.08  E-value=1.2e-05  Score=50.72  Aligned_cols=21  Identities=29%  Similarity=0.504  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|++|+|||||+.+
T Consensus         3 ~~f~I~vvG~sg~GKSTliN~   23 (276)
T cd01850           3 FQFNIMVVGESGLGKSTFINT   23 (276)
T ss_pred             cEEEEEEEcCCCCCHHHHHHH
Confidence            358999999999999999996

Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.

>cd01876 YihA_EngB The YihA (EngB) subfamily

Probab=98.03  E-value=6.5e-06  Score=46.41  Aligned_cols=18  Identities=39%  Similarity=0.575  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||||+.+
T Consensus         1 ~i~l~G~~g~GKTtL~~~   18 (170)
T cd01876           1 EIAFAGRSNVGKSSLINA   18 (170)
T ss_pred             CEEEEcCCCCCHHHHHHH
Confidence            478999999999999996

This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.

>cd01898 Obg Obg subfamily

Probab=98.02  E-value=9.5e-06  Score=46.47  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|+.++|||||+.+
T Consensus         2 ~v~ivG~~~~GKStl~~~   19 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSA   19 (170)
T ss_pred             CeEEECCCCCCHHHHHHH
Confidence            578999999999999985

The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.

>KOG4423|consensus

Probab=97.96  E-value=3.8e-07  Score=55.66  Aligned_cols=41  Identities=29%  Similarity=0.329  Sum_probs=36.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      ....+|+.++|+.|+|||+++.|      |....|+.+|..||| +|+
T Consensus        22 r~hL~k~lVig~~~vgkts~i~r------yv~~nfs~~yRAtIg-vdf   62 (229)
T KOG4423|consen   22 REHLFKVLVIGDLGVGKTSSIKR------YVHQNFSYHYRATIG-VDF   62 (229)
T ss_pred             hhhhhhhheeeeccccchhHHHH------HHHHHHHHHHHHHHh-HHH
Confidence            35679999999999999999998      999999999999999 554

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]

Probab=97.94  E-value=7e-07  Score=59.21  Aligned_cols=20  Identities=35%  Similarity=0.408  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-.+.++||+|||||+.+.+
T Consensus       203 ~~vi~LVGPTGVGKTTTlAK  222 (407)
T COG1419         203 KRVIALVGPTGVGKTTTLAK  222 (407)
T ss_pred             CcEEEEECCCCCcHHHHHHH
Confidence            45788999999999999987

>cd04104 p47_IIGP_like p47 (47-kDa) family

Probab=97.88  E-value=1.3e-05  Score=47.98  Aligned_cols=19  Identities=32%  Similarity=0.599  Sum_probs=17.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++++|++|+|||||+..
T Consensus         2 ~kI~i~G~~g~GKSSLin~   20 (197)
T cd04104           2 LNIAVTGESGAGKSSFINA   20 (197)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            6899999999999999986

The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1. They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens. p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma). ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis. TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro. IRG-47 is involved in resistance to T. gondii infection. LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections. IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues. In macrophages, IIGP1 interacts with hook3, a microtubule binding protei

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins

Probab=97.85  E-value=4.9e-05  Score=46.87  Aligned_cols=18  Identities=33%  Similarity=0.599  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++++|||+|+.+
T Consensus         2 ~v~lvG~~~~GKStLl~~   19 (233)
T cd01896           2 RVALVGFPSVGKSTLLSK   19 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999985

GTPases act as molecular switches regulating diverse cellular processes. DRG2 and DRG1 comprise the DRG subfamily in eukaryotes. In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes. It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.

>KOG1707|consensus

Probab=97.82  E-value=2.1e-05  Score=54.28  Aligned_cols=31  Identities=32%  Similarity=0.512  Sum_probs=24.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcccccccccccc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTT   46 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~   46 (65)
                      ....+|+++||.|||||||+..      ....+|.++
T Consensus         7 ~kdVRIvliGD~G~GKtSLImS------L~~eef~~~   37 (625)
T KOG1707|consen    7 LKDVRIVLIGDEGVGKTSLIMS------LLEEEFVDA   37 (625)
T ss_pred             ccceEEEEECCCCccHHHHHHH------HHhhhcccc
Confidence            4568999999999999999997      555555543

>cd04171 SelB SelB subfamily

Probab=97.81  E-value=4.3e-05  Score=43.28  Aligned_cols=18  Identities=39%  Similarity=0.324  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|+++||||||+.+
T Consensus         2 ~i~i~G~~~~GKssl~~~   19 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKA   19 (164)
T ss_pred             EEEEEecCCCCHHHHHHH
Confidence            578999999999999996

SelB is an elongation factor needed for the co-translational incorporation of selenocysteine. Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin. In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu). It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons. In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence). The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation. Archaeal and animal mechanisms of selenocysteine incorporation are more complex. Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily

Probab=97.80  E-value=3.7e-05  Score=45.57  Aligned_cols=19  Identities=26%  Similarity=0.370  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+.++|||||+.+
T Consensus         3 r~i~ivG~~~~GKTsL~~~   21 (194)
T cd01891           3 RNIAIIAHVDHGKTTLVDA   21 (194)
T ss_pred             cEEEEEecCCCCHHHHHHH
Confidence            4899999999999999997

BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants. BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well. The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli. It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes. It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes. In addition, BipA from enteropathogenic E. co

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes

Probab=97.76  E-value=7.9e-05  Score=41.74  Aligned_cols=19  Identities=47%  Similarity=0.789  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|++|+|||+++.+
T Consensus         2 ~~i~l~G~~~~GKstli~~   20 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNA   20 (157)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5899999999999999985

It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes. TrmE contains a GTPase domain that forms a canonical Ras-like fold. It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue. In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily

Probab=97.72  E-value=7.2e-05  Score=42.63  Aligned_cols=18  Identities=33%  Similarity=0.433  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++++|||||+.+
T Consensus         2 ~i~iiG~~~~GKtsli~~   19 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDK   19 (168)
T ss_pred             EEEEEecCCCCHHHHHHH
Confidence            488999999999999996

IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE

Probab=97.71  E-value=9.6e-05  Score=49.53  Aligned_cols=21  Identities=38%  Similarity=0.564  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+++||||||+.+
T Consensus       202 ~g~kVvIvG~~nvGKSSLiN~  222 (442)
T TIGR00450       202 DGFKLAIVGSPNVGKSSLLNA  222 (442)
T ss_pred             cCCEEEEECCCCCcHHHHHHH
Confidence            457999999999999999996

TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.

>TIGR03156 GTP_HflX GTP-binding protein HflX

Probab=97.69  E-value=9.6e-05  Score=48.21  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.+++|||||+.+
T Consensus       188 ~~~~ValvG~~NvGKSSLln~  208 (351)
T TIGR03156       188 DVPTVALVGYTNAGKSTLFNA  208 (351)
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            347999999999999999996

This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).

>PRK15494 era GTPase Era; Provisional

Probab=97.69  E-value=9.9e-05  Score=47.82  Aligned_cols=21  Identities=24%  Similarity=0.480  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|+++||||||+.+
T Consensus        51 k~~kV~ivG~~nvGKSTLin~   71 (339)
T PRK15494         51 KTVSVCIIGRPNSGKSTLLNR   71 (339)
T ss_pred             ceeEEEEEcCCCCCHHHHHHH
Confidence            456999999999999999996

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]

Probab=97.67  E-value=2.2e-05  Score=47.48  Aligned_cols=19  Identities=42%  Similarity=0.492  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|||||+.+.+
T Consensus         2 ~vi~lvGptGvGKTTt~aK   20 (196)
T PF00448_consen    2 KVIALVGPTGVGKTTTIAK   20 (196)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             EEEEEECCCCCchHhHHHH
Confidence            3678999999999999987

SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)

Probab=97.66  E-value=0.00016  Score=46.85  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|+++|.+||||||++.+
T Consensus        36 ~~~~rIllvGktGVGKSSliNs   57 (313)
T TIGR00991        36 VSSLTILVMGKGGVGKSSTVNS   57 (313)
T ss_pred             ccceEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999986

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1

Probab=97.65  E-value=4.4e-05  Score=43.74  Aligned_cols=15  Identities=47%  Similarity=0.656  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|++++|||||+.+
T Consensus         1 iiG~~~~GKStll~~   15 (176)
T cd01881           1 LVGLPNVGKSTLLNA   15 (176)
T ss_pred             CCCCCCCcHHHHHHH
Confidence            479999999999985

Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box). Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown. Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT. Nog1 is a nucleolar protein that might function in ribosome assembly. The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)

Probab=97.64  E-value=0.00014  Score=45.46  Aligned_cols=22  Identities=32%  Similarity=0.445  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|+++|.+||||||++.+
T Consensus        29 ~~~~~IllvG~tGvGKSSliNa   50 (249)
T cd01853          29 DFSLTILVLGKTGVGKSSTINS   50 (249)
T ss_pred             cCCeEEEEECCCCCcHHHHHHH
Confidence            4568999999999999999986

This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90. The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex. The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle. Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein. Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic. Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.

>PRK11058 GTPase HflX; Provisional

Probab=97.61  E-value=0.00012  Score=48.93  Aligned_cols=19  Identities=32%  Similarity=0.392  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|.+++|||||+.+
T Consensus       198 p~ValVG~~NaGKSSLlN~  216 (426)
T PRK11058        198 PTVSLVGYTNAGKSTLFNR  216 (426)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5899999999999999996

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways

Probab=97.60  E-value=0.00013  Score=42.59  Aligned_cols=19  Identities=32%  Similarity=0.503  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++++|++|+|||+|+.+
T Consensus         2 krimliG~~g~GKTTL~q~   20 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQA   20 (143)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4899999999999999986

Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process

>cd04163 Era Era subfamily

Probab=97.59  E-value=7.8e-05  Score=41.78  Aligned_cols=20  Identities=35%  Similarity=0.433  Sum_probs=18.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++++|+.|+||||++.+
T Consensus         3 ~~~i~~~G~~g~GKttl~~~   22 (168)
T cd04163           3 SGFVAIVGRPNVGKSTLLNA   22 (168)
T ss_pred             eeEEEEECCCCCCHHHHHHH
Confidence            57899999999999999986

Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily

Probab=97.56  E-value=5.6e-05  Score=42.63  Aligned_cols=15  Identities=53%  Similarity=0.775  Sum_probs=13.7

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+++||||||+.+
T Consensus         1 l~G~~~~GKssl~~~   15 (158)
T cd01879           1 LVGNPNVGKTTLFNA   15 (158)
T ss_pred             CCCCCCCCHHHHHHH
Confidence            479999999999996

E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.

>KOG3883|consensus

Probab=97.52  E-value=0.00018  Score=43.02  Aligned_cols=46  Identities=28%  Similarity=0.253  Sum_probs=35.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ...|++++|--+||||+++.+.++.    +.....++.|||.  |.|...++
T Consensus         8 k~~kVvVcG~k~VGKTaileQl~yg----~~~~~~e~~pTiE--DiY~~sve   53 (198)
T KOG3883|consen    8 KVCKVVVCGMKSVGKTAILEQLLYG----NHVPGTELHPTIE--DIYVASVE   53 (198)
T ss_pred             cceEEEEECCccccHHHHHHHHHhc----cCCCCCccccchh--hheeEeee
Confidence            4579999999999999999873322    3344567889999  88887765

>cd01895 EngA2 EngA2 subfamily

Probab=97.48  E-value=9.9e-05  Score=41.82  Aligned_cols=20  Identities=30%  Similarity=0.617  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++++|+.|+||||++.+
T Consensus         2 ~~~i~i~G~~~~GKstli~~   21 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNA   21 (174)
T ss_pred             CcEEEEEcCCCCCHHHHHHH
Confidence            36899999999999999986

This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

>TIGR02729 Obg_CgtA Obg family GTPase CgtA

Probab=97.47  E-value=0.00032  Score=45.41  Aligned_cols=52  Identities=21%  Similarity=0.183  Sum_probs=31.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccc-ccccccccceEEEEeeEE-EEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSL-SQLLTTHVPTVWAIDQYR-IYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~-~~~~~~~~~ti~~vd~~~-~~~~i~~   65 (65)
                      ..|.++|.+++|||||+.+ ++...... +...++..|+++.++.-. ..+.++|
T Consensus       158 adV~lvG~pnaGKSTLl~~-lt~~~~~va~y~fTT~~p~ig~v~~~~~~~~~i~D  211 (329)
T TIGR02729       158 ADVGLVGLPNAGKSTLISA-VSAAKPKIADYPFTTLVPNLGVVRVDDGRSFVIAD  211 (329)
T ss_pred             ccEEEEcCCCCCHHHHHHH-HhcCCccccCCCCCccCCEEEEEEeCCceEEEEEe
Confidence            4578999999999999995 33322111 111234678888443322 4555655

This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis

Probab=97.46  E-value=0.00011  Score=43.55  Aligned_cols=18  Identities=44%  Similarity=0.737  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|||||||+..
T Consensus        37 ~~vl~G~SGvGKSSLiN~   54 (161)
T PF03193_consen   37 TSVLLGQSGVGKSSLINA   54 (161)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478899999999999985

RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]

Probab=97.43  E-value=0.0001  Score=48.16  Aligned_cols=17  Identities=29%  Similarity=0.587  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++||||||||+++.-
T Consensus        32 ~vllGPSGcGKSTlLr~   48 (338)
T COG3839          32 VVLLGPSGCGKSTLLRM   48 (338)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78899999999999974

>cd01889 SelB_euk SelB subfamily

Probab=97.42  E-value=0.00024  Score=42.04  Aligned_cols=19  Identities=42%  Similarity=0.469  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|+.++|||||+.+
T Consensus         1 ~~i~i~G~~~~GKstLi~~   19 (192)
T cd01889           1 VNVGVLGHVDSGKTSLAKA   19 (192)
T ss_pred             CeEEEEecCCCCHHHHHHH
Confidence            4789999999999999986

SelB is an elongation factor needed for the co-translational incorporation of selenocysteine. Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin. In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu). It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons. In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence). The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation. Archaeal and animal mechanisms of selenocysteine incorporation are more complex. Although the SECIS elements have different secondary structures and conserved elements between archaea and euk

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions

Probab=97.41  E-value=0.00027  Score=41.63  Aligned_cols=31  Identities=23%  Similarity=0.399  Sum_probs=21.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL   44 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~   44 (65)
                      .+|.++|.++||||+|+.+ +++.......++
T Consensus         1 i~ialvG~PNvGKStLfN~-Ltg~~~~v~n~p   31 (156)
T PF02421_consen    1 IRIALVGNPNVGKSTLFNA-LTGAKQKVGNWP   31 (156)
T ss_dssp             -EEEEEESTTSSHHHHHHH-HHTTSEEEEEST
T ss_pred             CEEEEECCCCCCHHHHHHH-HHCCCceecCCC
Confidence            4789999999999999995 444333333333

FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse

Probab=97.40  E-value=0.00013  Score=39.89  Aligned_cols=18  Identities=39%  Similarity=0.708  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|.+++|||||+.+
T Consensus         1 ~V~iiG~~~~GKSTlin~   18 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINA   18 (116)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999985

These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....

>cd01899 Ygr210 Ygr210 subfamily

Probab=97.40  E-value=0.00027  Score=45.68  Aligned_cols=37  Identities=30%  Similarity=0.319  Sum_probs=25.1

Q ss_pred             EEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +.++|.++||||||+.+ +++.......|+ ..+.|++|
T Consensus         1 i~ivG~pnvGKStLfn~-lt~~~~~~~~~pftT~~p~~g   38 (318)
T cd01899           1 IGLVGKPNAGKSTFFNA-ATLADVEIANYPFTTIDPNVG   38 (318)
T ss_pred             CEEECCCCCCHHHHHHH-HhCCCCcccCCCCccccceeE
Confidence            46899999999999995 444433222222 45678887

Ygr210 is a member of Obg-like family and present in archaea and fungi. They are characterized by a distinct glycine-rich motif immediately following the Walker B motif. The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family. Among eukaryotes, the Ygr210 subfamily is represented only in fungi. These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=97.39  E-value=0.00013  Score=45.98  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|+||||||+|+.-
T Consensus        31 fvsilGpSGcGKSTLLri   48 (248)
T COG1116          31 FVAILGPSGCGKSTLLRL   48 (248)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367889999999999974

>PRK08118 topology modulation protein; Reviewed

Probab=97.38  E-value=0.00017  Score=42.47  Aligned_cols=19  Identities=26%  Similarity=0.454  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|++|+|||+++.+
T Consensus         2 ~rI~I~G~~GsGKSTlak~   20 (167)
T PRK08118          2 KKIILIGSGGSGKSTLARQ   20 (167)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3799999999999999985

>cd01894 EngA1 EngA1 subfamily

Probab=97.36  E-value=0.00026  Score=39.69  Aligned_cols=16  Identities=38%  Similarity=0.621  Sum_probs=14.4

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|++|+|||||+.+
T Consensus         1 ~l~G~~~~GKssl~~~   16 (157)
T cd01894           1 AIVGRPNVGKSTLFNR   16 (157)
T ss_pred             CccCCCCCCHHHHHHH
Confidence            3689999999999996

This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

>PRK09602 translation-associated GTPase; Reviewed

Probab=97.34  E-value=0.00057  Score=45.38  Aligned_cols=39  Identities=31%  Similarity=0.358  Sum_probs=26.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +|+.++|.++||||+|+.+ +++..+....++ .+..|++|
T Consensus         2 ~kigivG~pnvGKSTlfn~-Lt~~~~~~~~y~f~t~~p~~g   41 (396)
T PRK09602          2 ITIGLVGKPNVGKSTFFNA-ATLADVEIANYPFTTIDPNVG   41 (396)
T ss_pred             cEEEEECCCCCCHHHHHHH-HhCCcccccCCCCcceeeeee
Confidence            5899999999999999995 444333222222 23367777

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily

Probab=97.33  E-value=0.00017  Score=39.19  Aligned_cols=15  Identities=60%  Similarity=0.888  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+.|+|||+|+.+
T Consensus         1 iiG~~~~GKStl~~~   15 (157)
T cd00882           1 VVGDSGVGKTSLLNR   15 (157)
T ss_pred             CCCcCCCcHHHHHHH
Confidence            479999999999986

The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families. This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins. Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A

Probab=97.33  E-value=0.00018  Score=39.48  Aligned_cols=18  Identities=22%  Similarity=0.361  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++.|++|+|||+++.+
T Consensus         1 vI~I~G~~gsGKST~a~~   18 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKE   18 (121)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            478999999999999985

...

>cd04165 GTPBP1_like GTPBP1-like

Probab=97.33  E-value=0.00016  Score=44.45  Aligned_cols=18  Identities=33%  Similarity=0.634  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      |++++|+.++|||||+.+
T Consensus         1 ~v~~~G~~~~GKttl~~~   18 (224)
T cd04165           1 RVAVVGNVDAGKSTLLGV   18 (224)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999996

Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown. In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1. In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma). The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12. Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6. The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and

>PRK00093 GTP-binding protein Der; Reviewed

Probab=97.31  E-value=0.00046  Score=45.54  Aligned_cols=19  Identities=32%  Similarity=0.462  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++|+++|+++||||||+.+
T Consensus         2 ~~I~ivG~~~vGKStL~n~   20 (435)
T PRK00093          2 PVVAIVGRPNVGKSTLFNR   20 (435)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5899999999999999996

>PRK07261 topology modulation protein; Provisional

Probab=97.30  E-value=0.00023  Score=42.01  Aligned_cols=18  Identities=28%  Similarity=0.462  Sum_probs=16.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||+++..
T Consensus         2 ri~i~G~~GsGKSTla~~   19 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARK   19 (171)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            789999999999999985

>PRK03003 GTP-binding protein Der; Reviewed

Probab=97.30  E-value=0.00041  Score=46.63  Aligned_cols=21  Identities=29%  Similarity=0.460  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|++++|+++||||||+.+
T Consensus       210 ~~~kI~iiG~~nvGKSSLin~  230 (472)
T PRK03003        210 GPRRVALVGKPNVGKSSLLNK  230 (472)
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            458999999999999999996

>TIGR00436 era GTP-binding protein Era

Probab=97.26  E-value=0.00061  Score=42.61  Aligned_cols=18  Identities=28%  Similarity=0.503  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+++||||||+.+
T Consensus         2 ~V~liG~pnvGKSTLln~   19 (270)
T TIGR00436         2 FVAILGRPNVGKSTLLNQ   19 (270)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999996

Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.

>cd00881 GTP_translation_factor GTP translation factor family

Probab=97.26  E-value=0.00022  Score=41.14  Aligned_cols=18  Identities=28%  Similarity=0.322  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|+.|+|||+|+.+
T Consensus         1 ~v~v~G~~~~GKStlln~   18 (189)
T cd00881           1 NVGIAGHVDHGKTTLTER   18 (189)
T ss_pred             CEEEEeCCCCCHHHHHHH
Confidence            478999999999999986

This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation. In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]

Probab=97.25  E-value=0.00022  Score=42.96  Aligned_cols=19  Identities=32%  Similarity=0.506  Sum_probs=15.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      --++++|++|.|||+|..+
T Consensus         4 ~~vlL~Gps~SGKTaLf~~   22 (181)
T PF09439_consen    4 PTVLLVGPSGSGKTALFSQ   22 (181)
T ss_dssp             -EEEEE-STTSSHHHHHHH
T ss_pred             ceEEEEcCCCCCHHHHHHH
Confidence            3588999999999999996

SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed

Probab=97.25  E-value=0.00058  Score=45.81  Aligned_cols=21  Identities=43%  Similarity=0.616  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++++|||||+.+
T Consensus       214 ~~~kV~ivG~~nvGKSSLln~  234 (449)
T PRK05291        214 EGLKVVIAGRPNVGKSSLLNA  234 (449)
T ss_pred             cCCEEEEECCCCCCHHHHHHH
Confidence            347999999999999999996

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]

Probab=97.24  E-value=0.00023  Score=42.60  Aligned_cols=18  Identities=22%  Similarity=0.482  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||+++.+
T Consensus         2 riiilG~pGaGK~T~A~~   19 (178)
T COG0563           2 RILILGPPGAGKSTLAKK   19 (178)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            789999999999999986

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []

Probab=97.23  E-value=0.00026  Score=45.04  Aligned_cols=21  Identities=33%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|+++++|++|+|||+++..
T Consensus         3 ~~fnImVvG~sG~GKTTFInt   23 (281)
T PF00735_consen    3 FNFNIMVVGESGLGKTTFINT   23 (281)
T ss_dssp             EEEEEEEEECTTSSHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHH
Confidence            368999999999999999985

Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.

>cd01856 YlqF YlqF

Probab=97.22  E-value=0.0008  Score=39.38  Aligned_cols=21  Identities=38%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.++||||+++.+
T Consensus       114 ~~~~~~~~G~~~vGKstlin~  134 (171)
T cd01856         114 RGIRAMVVGIPNVGKSTLINR  134 (171)
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            447899999999999999985

Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.

>PRK10078 ribose 1,5-bisphosphokinase; Provisional

Probab=97.20  E-value=0.00035  Score=41.46  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         4 ~i~l~G~sGsGKsTl~~~   21 (186)
T PRK10078          4 LIWLMGPSGSGKDSLLAA   21 (186)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999985

>cd01890 LepA LepA subfamily

Probab=97.20  E-value=0.00022  Score=41.18  Aligned_cols=18  Identities=17%  Similarity=0.255  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|+.++|||||+.+
T Consensus         2 ni~~vG~~~~GKssL~~~   19 (179)
T cd01890           2 NFSIIAHIDHGKSTLADR   19 (179)
T ss_pred             cEEEEeecCCCHHHHHHH
Confidence            688999999999999996

LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome. LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea. This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont. Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=97.19  E-value=0.00027  Score=46.42  Aligned_cols=17  Identities=29%  Similarity=0.540  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++||||||||+++.-
T Consensus        34 ~~lLGPSGcGKTTlLR~   50 (352)
T COG3842          34 VTLLGPSGCGKTTLLRM   50 (352)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria

Probab=97.19  E-value=0.00074  Score=40.98  Aligned_cols=19  Identities=26%  Similarity=0.489  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++|+++|.+|+|||++...
T Consensus         1 l~IlllG~tGsGKSs~~N~   19 (212)
T PF04548_consen    1 LRILLLGKTGSGKSSLGNS   19 (212)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4799999999999999985

The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 []. The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....

>smart00382 AAA ATPases associated with a variety of cellular activities

Probab=97.19  E-value=0.00041  Score=37.45  Aligned_cols=19  Identities=37%  Similarity=0.433  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus         3 ~~~~l~G~~G~GKTtl~~~   21 (148)
T smart00382        3 EVILIVGPPGSGKTTLARA   21 (148)
T ss_pred             CEEEEECCCCCcHHHHHHH
Confidence            3678999999999999985

AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.

>cd01857 HSR1_MMR1 HSR1/MMR1

Probab=97.16  E-value=0.00042  Score=39.38  Aligned_cols=18  Identities=44%  Similarity=0.512  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|.++||||+++.+
T Consensus        85 ~~~~~G~~~vGKstlin~  102 (141)
T cd01857          85 TIGLVGYPNVGKSSLINA  102 (141)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            899999999999999985

Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.

>PRK15467 ethanolamine utilization protein EutP; Provisional

Probab=97.15  E-value=0.00043  Score=40.13  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=17.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|++++|||+|+.+
T Consensus         3 ~i~~iG~~~~GKstl~~~   20 (158)
T PRK15467          3 RIAFVGAVGAGKTTLFNA   20 (158)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999985

>PRK12296 obgE GTPase CgtA; Reviewed

Probab=97.15  E-value=0.001  Score=45.54  Aligned_cols=52  Identities=21%  Similarity=0.198  Sum_probs=30.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccc-cccccccccceEEEEeeEEEEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVS-LSQLLTTHVPTVWAIDQYRIYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~-~~~~~~~~~~ti~~vd~~~~~~~i~~   65 (65)
                      .+|.++|.+++|||||+.+ ++..... .+...++..|.++.++.-...+.++|
T Consensus       160 adV~LVG~PNAGKSTLln~-Ls~akpkIadypfTTl~P~lGvv~~~~~~f~laD  212 (500)
T PRK12296        160 ADVGLVGFPSAGKSSLISA-LSAAKPKIADYPFTTLVPNLGVVQAGDTRFTVAD  212 (500)
T ss_pred             ceEEEEEcCCCCHHHHHHH-HhcCCccccccCcccccceEEEEEECCeEEEEEE
Confidence            5689999999999999985 3322111 11111233466664444344555554

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA

Probab=97.13  E-value=0.00078  Score=44.28  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+++||||||+.+
T Consensus         1 ~i~ivG~~nvGKStL~n~   18 (429)
T TIGR03594         1 VVAIVGRPNVGKSTLFNR   18 (429)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999996

EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.

>KOG0070|consensus

Probab=97.13  E-value=0.00034  Score=42.23  Aligned_cols=36  Identities=33%  Similarity=0.575  Sum_probs=30.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|+++|=-+.|||+++.+      +..+++... .||||
T Consensus        15 ~~e~~IlmlGLD~AGKTTILyk------Lk~~E~vtt-vPTiG   50 (181)
T KOG0070|consen   15 KKEMRILMVGLDAAGKTTILYK------LKLGEIVTT-VPTIG   50 (181)
T ss_pred             cceEEEEEEeccCCCceeeeEe------eccCCcccC-CCccc
Confidence            4568999999999999999998      777777766 89987

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]

Probab=97.12  E-value=0.00042  Score=43.29  Aligned_cols=17  Identities=29%  Similarity=0.599  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .++++||||+|||+|++
T Consensus        30 vv~iiGpSGSGKSTlLR   46 (240)
T COG1126          30 VVVIIGPSGSGKSTLLR   46 (240)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999996

>PRK14738 gmk guanylate kinase; Provisional

Probab=97.12  E-value=0.00079  Score=40.74  Aligned_cols=21  Identities=24%  Similarity=0.463  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|++|+|||+|+.+
T Consensus        12 ~~~~ivi~GpsG~GK~tl~~~   32 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVLAR   32 (206)
T ss_pred             CCeEEEEECcCCCCHHHHHHH
Confidence            445678899999999999985

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=97.12  E-value=0.00055  Score=42.64  Aligned_cols=18  Identities=39%  Similarity=0.562  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|+||||||+|+.-
T Consensus        33 ~vv~lGpSGcGKTTLLnl   50 (259)
T COG4525          33 LVVVLGPSGCGKTTLLNL   50 (259)
T ss_pred             EEEEEcCCCccHHHHHHH
Confidence            378899999999999973

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)

Probab=97.12  E-value=0.0013  Score=39.09  Aligned_cols=19  Identities=32%  Similarity=0.448  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|.+|+|||+++..
T Consensus         1 ~~i~lvG~~g~GKSsl~N~   19 (196)
T cd01852           1 LRLVLVGKTGAGKSATGNT   19 (196)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3689999999999999986

This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family. The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections. The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=97.11  E-value=0.00047  Score=41.14  Aligned_cols=19  Identities=37%  Similarity=0.513  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+..
T Consensus        22 ~~~~l~G~nG~GKSTLl~~   40 (176)
T cd03238          22 VLVVVTGVSGSGKSTLVNE   40 (176)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3578999999999999974

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed

Probab=97.10  E-value=0.00076  Score=47.47  Aligned_cols=20  Identities=35%  Similarity=0.591  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++++|+++||||||+.+
T Consensus       450 ~~kI~ivG~~nvGKSSLin~  469 (712)
T PRK09518        450 LRRVALVGRPNVGKSSLLNQ  469 (712)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport

Probab=97.08  E-value=0.00052  Score=37.66  Aligned_cols=17  Identities=35%  Similarity=0.442  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++..
T Consensus         1 ill~G~~G~GKT~l~~~   17 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARA   17 (132)
T ss_dssp             EEEESSTTSSHHHHHHH
T ss_pred             CEEECcCCCCeeHHHHH
Confidence            57899999999999975

Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []

Probab=97.07  E-value=0.00033  Score=39.44  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++..
T Consensus         2 vlL~G~~G~GKt~l~~~   18 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLARE   18 (139)
T ss_dssp             EEEEESSSSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78999999999999985

The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B

Probab=97.06  E-value=0.00042  Score=38.85  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++.+
T Consensus         2 ii~~G~pgsGKSt~a~~   18 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKR   18 (143)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999986

...

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2

Probab=97.06  E-value=0.00054  Score=39.11  Aligned_cols=17  Identities=35%  Similarity=0.567  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++.+
T Consensus         2 i~i~GpsGsGKstl~~~   18 (137)
T cd00071           2 IVLSGPSGVGKSTLLKR   18 (137)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57889999999999985

7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.

>PRK03003 GTP-binding protein Der; Reviewed

Probab=97.06  E-value=0.0013  Score=44.19  Aligned_cols=20  Identities=40%  Similarity=0.546  Sum_probs=18.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|+++|+++||||||+.+
T Consensus        38 ~~~V~IvG~~nvGKSSL~nr   57 (472)
T PRK03003         38 LPVVAVVGRPNVGKSTLVNR   57 (472)
T ss_pred             CCEEEEEcCCCCCHHHHHHH
Confidence            46899999999999999996

>cd01859 MJ1464 MJ1464

Probab=97.06  E-value=0.0014  Score=37.58  Aligned_cols=21  Identities=43%  Similarity=0.434  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|.+++|||+++.+
T Consensus       100 ~~~~~~~ig~~~~Gkssl~~~  120 (156)
T cd01859         100 KEGKVGVVGYPNVGKSSIINA  120 (156)
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            346889999999999999986

This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]

Probab=97.05  E-value=0.00049  Score=42.83  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++||||+|||+|+.-
T Consensus        33 ~vaI~GpSGSGKSTLLni   50 (226)
T COG1136          33 FVAIVGPSGSGKSTLLNL   50 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            378899999999999974

>PRK09554 feoB ferrous iron transport protein B; Reviewed

Probab=97.05  E-value=0.0017  Score=46.41  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++.++|.++||||+|..+
T Consensus         3 ~~~IaLvG~pNvGKSTLfN~   22 (772)
T PRK09554          3 KLTIGLIGNPNSGKTTLFNQ   22 (772)
T ss_pred             ceEEEEECCCCCCHHHHHHH
Confidence            46899999999999999996

>PRK14737 gmk guanylate kinase; Provisional

Probab=97.05  E-value=0.00054  Score=41.08  Aligned_cols=19  Identities=21%  Similarity=0.244  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++||+|+|||+|+.+
T Consensus         5 ~~ivl~GpsG~GK~tl~~~   23 (186)
T PRK14737          5 KLFIISSVAGGGKSTIIQA   23 (186)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3478999999999999985

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A

Probab=97.05  E-value=0.00042  Score=40.16  Aligned_cols=19  Identities=32%  Similarity=0.532  Sum_probs=13.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++.+
T Consensus        25 ~~~ll~G~~G~GKT~ll~~   43 (185)
T PF13191_consen   25 RNLLLTGESGSGKTSLLRA   43 (185)
T ss_dssp             --EEE-B-TTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5688999999999999985

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN

Probab=97.03  E-value=0.00059  Score=39.95  Aligned_cols=18  Identities=33%  Similarity=0.399  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         3 ~~~i~G~sGsGKttl~~~   20 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLLDY   20 (179)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]

Probab=97.02  E-value=0.00065  Score=41.34  Aligned_cols=19  Identities=37%  Similarity=0.560  Sum_probs=16.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.||||||||+++.+
T Consensus         5 ~l~vlsgPSG~GKsTl~k~   23 (191)
T COG0194           5 LLIVLSGPSGVGKSTLVKA   23 (191)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3467889999999999985

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis

Probab=97.01  E-value=0.00059  Score=38.02  Aligned_cols=18  Identities=33%  Similarity=0.641  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        17 ~v~I~GpSGsGKSTLl~~   34 (107)
T cd00820          17 GVLITGDSGIGKTELALE   34 (107)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            478899999999999974

It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold

Probab=97.00  E-value=0.00069  Score=37.00  Aligned_cols=19  Identities=32%  Similarity=0.389  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        20 ~~v~i~G~~G~GKT~l~~~   38 (151)
T cd00009          20 KNLLLYGPPGTGKTTLARA   38 (151)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3588999999999999985

The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

>KOG0073|consensus

Probab=96.99  E-value=0.0018  Score=39.01  Aligned_cols=36  Identities=22%  Similarity=0.274  Sum_probs=28.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+.|+++|..+.|||+++.+      +.... .+...||.|
T Consensus        14 erE~riLiLGLdNsGKTti~~k------l~~~~-~~~i~pt~g   49 (185)
T KOG0073|consen   14 EREVRILILGLDNSGKTTIVKK------LLGED-TDTISPTLG   49 (185)
T ss_pred             hheeEEEEEecCCCCchhHHHH------hcCCC-ccccCCccc
Confidence            4579999999999999999997      65433 455567766

>TIGR03263 guanyl_kin guanylate kinase

Probab=96.98  E-value=0.00069  Score=39.56  Aligned_cols=18  Identities=39%  Similarity=0.582  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         3 ii~l~G~~GsGKsTl~~~   20 (180)
T TIGR03263         3 LIVISGPSGVGKSTLVKA   20 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA

Probab=96.97  E-value=0.0027  Score=41.72  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++++|||||+.+
T Consensus       171 ~~~~v~ivG~~~~GKSsLin~  191 (429)
T TIGR03594       171 GPIKIAIIGRPNVGKSTLVNA  191 (429)
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            458999999999999999986

EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A

Probab=96.96  E-value=0.00069  Score=39.22  Aligned_cols=18  Identities=44%  Similarity=0.658  Sum_probs=14.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ||++.|..++|||+|+.+
T Consensus         1 rI~i~G~~stGKTTL~~~   18 (163)
T PF13521_consen    1 RIVITGGPSTGKTTLIEA   18 (163)
T ss_dssp             -EEEE--TTSHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            789999999999999986

>PRK12297 obgE GTPase CgtA; Reviewed

Probab=96.95  E-value=0.0023  Score=42.96  Aligned_cols=18  Identities=33%  Similarity=0.479  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.++||||||+.+
T Consensus       160 dVglVG~pNaGKSTLLn~  177 (424)
T PRK12297        160 DVGLVGFPNVGKSTLLSV  177 (424)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            588999999999999985

>TIGR03499 FlhF flagellar biosynthetic protein FlhF

Probab=96.95  E-value=0.00067  Score=43.01  Aligned_cols=20  Identities=35%  Similarity=0.348  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++.+
T Consensus       194 ~~vi~~vGptGvGKTTt~~k  213 (282)
T TIGR03499       194 GGVIALVGPTGVGKTTTLAK  213 (282)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            34678999999999999986

>PF13555 AAA_29: P-loop containing region of AAA domain

Probab=96.95  E-value=0.0008  Score=34.13  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++.|++|+|||+++-.
T Consensus        25 ~tli~G~nGsGKSTllDA   42 (62)
T PF13555_consen   25 VTLITGPNGSGKSTLLDA   42 (62)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            378889999999999965

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems

Probab=96.95  E-value=0.00065  Score=37.94  Aligned_cols=18  Identities=33%  Similarity=0.517  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        13 ~~~i~G~nGsGKStLl~~   30 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLLKA   30 (137)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEccCCCccccceee
Confidence            578999999999999974

ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain []. The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ]. The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B

Probab=96.95  E-value=0.00044  Score=38.17  Aligned_cols=18  Identities=39%  Similarity=0.447  Sum_probs=14.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++.+
T Consensus         6 ~~~i~G~~G~GKT~~~~~   23 (131)
T PF13401_consen    6 ILVISGPPGSGKTTLIKR   23 (131)
T ss_dssp             -EEEEE-TTSSHHHHHHH
T ss_pred             ccEEEcCCCCCHHHHHHH
Confidence            467889999999999986

>PRK06217 hypothetical protein; Validated

Probab=96.94  E-value=0.00087  Score=39.65  Aligned_cols=19  Identities=26%  Similarity=0.405  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|.+|+|||++..+
T Consensus         2 ~~I~i~G~~GsGKSTla~~   20 (183)
T PRK06217          2 MRIHITGASGSGTTTLGAA   20 (183)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4799999999999999986

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=96.93  E-value=0.00085  Score=45.16  Aligned_cols=19  Identities=32%  Similarity=0.501  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++.++|++|+|||+++.+
T Consensus       242 ~vI~LVGptGvGKTTTiaK  260 (436)
T PRK11889        242 QTIALIGPTGVGKTTTLAK  260 (436)
T ss_pred             cEEEEECCCCCcHHHHHHH
Confidence            5789999999999999986

>PF05729 NACHT: NACHT domain

Probab=96.92  E-value=0.00067  Score=38.44  Aligned_cols=17  Identities=24%  Similarity=0.436  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++.+
T Consensus         3 l~I~G~~G~GKStll~~   19 (166)
T PF05729_consen    3 LWISGEPGSGKSTLLRK   19 (166)
T ss_pred             EEEECCCCCChHHHHHH
Confidence            68899999999999985

>PRK00089 era GTPase Era; Reviewed

Probab=96.91  E-value=0.0013  Score=41.31  Aligned_cols=21  Identities=33%  Similarity=0.431  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|.++|+.|+|||||+.+
T Consensus         4 ~~g~V~iiG~pn~GKSTLin~   24 (292)
T PRK00089          4 KSGFVAIVGRPNVGKSTLLNA   24 (292)
T ss_pred             eeEEEEEECCCCCCHHHHHHH
Confidence            456789999999999999985

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein

Probab=96.89  E-value=0.00083  Score=42.13  Aligned_cols=22  Identities=32%  Similarity=0.605  Sum_probs=19.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|.+|+|||+++..
T Consensus        11 ~~~fr~viIG~sGSGKT~li~~   32 (241)
T PF04665_consen   11 KDPFRMVIIGKSGSGKTTLIKS   32 (241)
T ss_pred             CCCceEEEECCCCCCHHHHHHH
Confidence            4468999999999999998874

This is thought to be an ATPase involved in viral DNA packaging [].

>COG1162 Predicted GTPases [General function prediction only]

Probab=96.88  E-value=0.00081  Score=43.43  Aligned_cols=18  Identities=44%  Similarity=0.685  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++|.||||||||+.+
T Consensus       166 ~svl~GqSGVGKSSLiN~  183 (301)
T COG1162         166 ITVLLGQSGVGKSTLINA  183 (301)
T ss_pred             eEEEECCCCCcHHHHHHh
Confidence            467889999999999986

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=96.86  E-value=0.00074  Score=42.32  Aligned_cols=17  Identities=24%  Similarity=0.561  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      -.++||||||||+++.-
T Consensus        36 TAlIGPSGcGKST~LR~   52 (253)
T COG1117          36 TALIGPSGCGKSTLLRC   52 (253)
T ss_pred             EEEECCCCcCHHHHHHH
Confidence            46889999999999963

>PRK00300 gmk guanylate kinase; Provisional

Probab=96.85  E-value=0.00093  Score=39.83  Aligned_cols=19  Identities=32%  Similarity=0.503  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+..
T Consensus         6 ~~i~i~G~sGsGKstl~~~   24 (205)
T PRK00300          6 LLIVLSGPSGAGKSTLVKA   24 (205)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3578999999999999974

>cd01858 NGP_1 NGP-1

Probab=96.84  E-value=0.0011  Score=38.12  Aligned_cols=20  Identities=25%  Similarity=0.421  Sum_probs=17.9

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|.++||||||+.+
T Consensus       102 ~~~v~~~G~~nvGKStliN~  121 (157)
T cd01858         102 QISVGFIGYPNVGKSSIINT  121 (157)
T ss_pred             ceEEEEEeCCCCChHHHHHH
Confidence            46788999999999999986

Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.

>PRK12288 GTPase RsgA; Reviewed

Probab=96.82  E-value=0.001  Score=43.51  Aligned_cols=17  Identities=47%  Similarity=0.771  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|.+|||||||+.+
T Consensus       208 ~~~vG~sgVGKSTLiN~  224 (347)
T PRK12288        208 SIFVGQSGVGKSSLINA  224 (347)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999986

>PF13173 AAA_14: AAA domain

Probab=96.81  E-value=0.00095  Score=37.39  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.+||||+++.+
T Consensus         4 ~~~l~G~R~vGKTtll~~   21 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLLKQ   21 (128)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            467889999999999986

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]

Probab=96.79  E-value=0.0011  Score=42.05  Aligned_cols=17  Identities=24%  Similarity=0.444  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++||+|+|||+|+..
T Consensus        31 ~~iiGpNG~GKSTLLk~   47 (258)
T COG1120          31 TGILGPNGSGKSTLLKC   47 (258)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=96.78  E-value=0.0016  Score=41.17  Aligned_cols=17  Identities=24%  Similarity=0.610  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|++.
T Consensus        33 VaiIG~SGaGKSTLLR~   49 (258)
T COG3638          33 VAIIGPSGAGKSTLLRS   49 (258)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            78899999999999964

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []

Probab=96.78  E-value=0.0014  Score=38.87  Aligned_cols=18  Identities=33%  Similarity=0.525  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++-|+.|+|||+++.+
T Consensus         1 ~i~iTG~pG~GKTTll~k   18 (168)
T PF03266_consen    1 HIFITGPPGVGKTTLLKK   18 (168)
T ss_dssp             EEEEES-TTSSHHHHHHH
T ss_pred             CEEEECcCCCCHHHHHHH
Confidence            688999999999999986

It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase []. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme []. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [].; GO: 0005524 ATP binding, 0016740 transferase activity, 0019204 nucleotide phosphatase activity; PDB: 1YE8_A 2I3B_A.

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP

Probab=96.77  E-value=0.00082  Score=39.92  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=16.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|+.|+|||+|+..
T Consensus        21 ~~~~l~G~rg~GKTsLl~~   39 (234)
T PF01637_consen   21 QHILLYGPRGSGKTSLLKE   39 (234)
T ss_dssp             SEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEEcCCcCCHHHHHHH
Confidence            3577889999999999985

; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.

>PRK05541 adenylylsulfate kinase; Provisional

Probab=96.77  E-value=0.0023  Score=37.41  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+++.|.+|+|||+++..
T Consensus         7 ~~~I~i~G~~GsGKst~a~~   26 (176)
T PRK05541          7 GYVIWITGLAGSGKTTIAKA   26 (176)
T ss_pred             CCEEEEEcCCCCCHHHHHHH
Confidence            35789999999999999974

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional

Probab=96.77  E-value=0.0011  Score=44.35  Aligned_cols=20  Identities=30%  Similarity=0.400  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|++|||||+++.+
T Consensus       206 ~~ii~lvGptGvGKTTt~ak  225 (407)
T PRK12726        206 HRIISLIGQTGVGKTTTLVK  225 (407)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            34678999999999999986

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)

Probab=96.76  E-value=0.0013  Score=39.56  Aligned_cols=18  Identities=28%  Similarity=0.473  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~nGsGKSTLl~~   49 (218)
T cd03255          32 FVAIVGPSGSGKSTLLNI   49 (218)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974

They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.

>PRK12299 obgE GTPase CgtA; Reviewed

Probab=96.76  E-value=0.0037  Score=40.72  Aligned_cols=52  Identities=19%  Similarity=0.141  Sum_probs=29.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccc-ccccccccceEEEEee-EEEEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSL-SQLLTTHVPTVWAIDQ-YRIYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~-~~~~~~~~~ti~~vd~-~~~~~~i~~   65 (65)
                      ..|.++|.+++|||||+.+ +++..... +...++..|.++.++. -...+.++|
T Consensus       159 adVglVG~PNaGKSTLln~-ls~a~~~va~ypfTT~~p~~G~v~~~~~~~~~i~D  212 (335)
T PRK12299        159 ADVGLVGLPNAGKSTLISA-VSAAKPKIADYPFTTLHPNLGVVRVDDYKSFVIAD  212 (335)
T ss_pred             CCEEEEcCCCCCHHHHHHH-HHcCCCccCCCCCceeCceEEEEEeCCCcEEEEEe
Confidence            3478999999999999985 33221111 1112345677774332 113455554

>PRK05480 uridine/cytidine kinase; Provisional

Probab=96.75  E-value=0.0019  Score=38.81  Aligned_cols=21  Identities=19%  Similarity=0.322  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||+|+..
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~   25 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVAST   25 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHH
Confidence            457899999999999999975

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF

Probab=96.75  E-value=0.0033  Score=39.60  Aligned_cols=21  Identities=33%  Similarity=0.559  Sum_probs=18.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.++|.++|||||++.+
T Consensus       117 ~~~~~~~vG~~nvGKSslin~  137 (276)
T TIGR03596       117 RPIRAMIVGIPNVGKSTLINR  137 (276)
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            357899999999999999985

Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1

Probab=96.74  E-value=0.0024  Score=39.80  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      |++++|++++||||+..-
T Consensus         1 KiLLmG~~~SGKTSi~~v   18 (232)
T PF04670_consen    1 KILLMGPRRSGKTSIRSV   18 (232)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEEcCCCCChhhHHHH
Confidence            799999999999998853

RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.

>TIGR00487 IF-2 translation initiation factor IF-2

Probab=96.73  E-value=0.0043  Score=43.15  Aligned_cols=21  Identities=24%  Similarity=0.332  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|+.++|||||+.+
T Consensus        86 r~p~V~I~Ghvd~GKTSLl~~  106 (587)
T TIGR00487        86 RPPVVTIMGHVDHGKTSLLDS  106 (587)
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            457899999999999999996

This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU.

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional

Probab=96.72  E-value=0.002  Score=42.83  Aligned_cols=19  Identities=42%  Similarity=0.545  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|||||+++.+
T Consensus       175 ~vi~lvGptGvGKTTT~aK  193 (388)
T PRK12723        175 RVFILVGPTGVGKTTTIAK  193 (388)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4788999999999999986

>PHA00729 NTP-binding motif containing protein

Probab=96.72  E-value=0.0018  Score=40.34  Aligned_cols=19  Identities=32%  Similarity=0.468  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++.|++|+|||+++.+
T Consensus        18 ~nIlItG~pGvGKT~LA~a   36 (226)
T PHA00729         18 VSAVIFGKQGSGKTTYALK   36 (226)
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4799999999999999986

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family

Probab=96.71  E-value=0.0012  Score=38.16  Aligned_cols=17  Identities=29%  Similarity=0.499  Sum_probs=14.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||++...
T Consensus         1 i~l~G~~GsGKSTla~~   17 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASA   17 (163)
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            46889999999999875

This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2

Probab=96.71  E-value=0.0015  Score=38.55  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++||+|+||++|..+
T Consensus         4 ~ivl~Gpsg~GK~~l~~~   21 (183)
T PF00625_consen    4 PIVLVGPSGSGKSTLAKR   21 (183)
T ss_dssp             EEEEESSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            368899999999999985

7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....

>smart00072 GuKc Guanylate kinase homologues

Probab=96.70  E-value=0.0015  Score=38.68  Aligned_cols=18  Identities=33%  Similarity=0.549  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+||++++.+
T Consensus         4 ~ivl~Gpsg~GK~tl~~~   21 (184)
T smart00072        4 PIVLSGPSGVGKGTLLAE   21 (184)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985

Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein

Probab=96.70  E-value=0.0016  Score=39.21  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (216)
T TIGR00960        31 MVFLVGHSGAGKSTFLKL   48 (216)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

>TIGR00157 ribosome small subunit-dependent GTPase A

Probab=96.70  E-value=0.0015  Score=40.72  Aligned_cols=18  Identities=44%  Similarity=0.634  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++|.+|||||||+.+
T Consensus       122 ~~~~~G~sgvGKStLiN~  139 (245)
T TIGR00157       122 ISVFAGQSGVGKSSLINA  139 (245)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999986

The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=96.70  E-value=0.0016  Score=38.93  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (205)
T cd03226          28 IIALTGKNGAGKTTLAKI   45 (205)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>PRK10416 signal recognition particle-docking protein FtsY; Provisional

Probab=96.69  E-value=0.0015  Score=42.20  Aligned_cols=20  Identities=40%  Similarity=0.403  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++.+
T Consensus       114 ~~vi~lvGpnGsGKTTt~~k  133 (318)
T PRK10416        114 PFVILVVGVNGVGKTTTIGK  133 (318)
T ss_pred             CeEEEEECCCCCcHHHHHHH
Confidence            35678999999999999986

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []

Probab=96.69  E-value=0.002  Score=38.23  Aligned_cols=20  Identities=35%  Similarity=0.458  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++||+|||||.++..
T Consensus         3 ~~~~ll~GpsGvGKT~la~~   22 (171)
T PF07724_consen    3 KSNFLLAGPSGVGKTELAKA   22 (171)
T ss_dssp             SEEEEEESSTTSSHHHHHHH
T ss_pred             EEEEEEECCCCCCHHHHHHH
Confidence            35789999999999999875

The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=96.68  E-value=0.0014  Score=42.14  Aligned_cols=17  Identities=29%  Similarity=0.417  Sum_probs=14.9

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      -++++|+||+|||+++.
T Consensus        29 f~vliGpSGsGKTTtLk   45 (309)
T COG1125          29 FLVLIGPSGSGKTTTLK   45 (309)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            36788999999999996

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein

Probab=96.68  E-value=0.0017  Score=39.71  Aligned_cols=18  Identities=22%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (243)
T TIGR02315        30 FVAIIGPSGAGKSTLLRC   47 (243)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C

Probab=96.67  E-value=0.0014  Score=35.78  Aligned_cols=17  Identities=24%  Similarity=0.225  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++.|.+|+|||+++..
T Consensus         1 I~i~G~~GsGKtTia~~   17 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKE   17 (129)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            57889999999999984

...

>cd04167 Snu114p Snu114p subfamily

Probab=96.67  E-value=0.0013  Score=39.68  Aligned_cols=18  Identities=28%  Similarity=0.409  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.++|||+|+.+
T Consensus         2 nv~iiG~~~~GKTtL~~~   19 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDM   19 (213)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            688999999999999986

Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle. U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns. Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2. This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.

>TIGR00101 ureG urease accessory protein UreG

Probab=96.66  E-value=0.002  Score=39.00  Aligned_cols=19  Identities=47%  Similarity=0.503  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +++.++|+.|+|||+++.+
T Consensus         2 ~~i~i~G~~GsGKTTll~~   20 (199)
T TIGR00101         2 LKIGVAGPVGSGKTALIEA   20 (199)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            6899999999999999985

This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=96.66  E-value=0.0018  Score=38.80  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (211)
T cd03225          29 FVLIVGPNGSGKSTLLRL   46 (211)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>cd04178 Nucleostemin_like Nucleostemin-like

Probab=96.66  E-value=0.0039  Score=36.99  Aligned_cols=20  Identities=40%  Similarity=0.473  Sum_probs=18.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.++|.++||||||+.+
T Consensus       117 ~~~~~~vG~pnvGKSslin~  136 (172)
T cd04178         117 SITVGVVGFPNVGKSSLINS  136 (172)
T ss_pred             CcEEEEEcCCCCCHHHHHHH
Confidence            36899999999999999986

Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues. NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type. Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division. Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain. Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component

Probab=96.65  E-value=0.0016  Score=39.11  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~i~G~nGsGKSTLl~~   44 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRI   44 (211)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            678999999999999974

The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity

Probab=96.65  E-value=0.0018  Score=38.79  Aligned_cols=18  Identities=28%  Similarity=0.303  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (210)
T cd03269          28 IFGLLGPNGAGKTTTIRM   45 (210)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily

Probab=96.65  E-value=0.0017  Score=40.03  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++.+
T Consensus        45 ~~~l~G~~G~GKTtl~~~   62 (269)
T TIGR03015        45 FILITGEVGAGKTTLIRN   62 (269)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            578999999999999985

Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.

>TIGR00235 udk uridine kinase

Probab=96.64  E-value=0.0026  Score=38.31  Aligned_cols=20  Identities=20%  Similarity=0.172  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+.+.|++|+|||+|+..
T Consensus         6 g~vi~I~G~sGsGKSTl~~~   25 (207)
T TIGR00235         6 GIIIGIGGGSGSGKTTVARK   25 (207)
T ss_pred             eEEEEEECCCCCCHHHHHHH
Confidence            35688999999999999975

Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane

Probab=96.63  E-value=0.0019  Score=38.70  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (214)
T cd03292          29 FVFLVGPSGAGKSTLLKL   46 (214)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids

Probab=96.63  E-value=0.0019  Score=38.94  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (222)
T cd03224          28 IVALLGRNGAGKTTLLKT   45 (222)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A

Probab=96.63  E-value=0.002  Score=40.80  Aligned_cols=19  Identities=37%  Similarity=0.522  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||.++..
T Consensus        34 ~pvLl~G~~GtGKT~li~~   52 (272)
T PF12775_consen   34 RPVLLVGPSGTGKTSLIQN   52 (272)
T ss_dssp             EEEEEESSTTSSHHHHHHH
T ss_pred             CcEEEECCCCCchhHHHHh
Confidence            5689999999999999986

>PRK13695 putative NTPase; Provisional

Probab=96.63  E-value=0.002  Score=37.72  Aligned_cols=19  Identities=37%  Similarity=0.539  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++.|++|+|||+++..
T Consensus         1 ~~i~ltG~~G~GKTTll~~   19 (174)
T PRK13695          1 MKIGITGPPGVGKTTLVLK   19 (174)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4789999999999999985

>PRK12289 GTPase RsgA; Reviewed

Probab=96.63  E-value=0.0016  Score=42.77  Aligned_cols=17  Identities=47%  Similarity=0.675  Sum_probs=15.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|||||||+.+
T Consensus       175 ~v~iG~SgVGKSSLIN~  191 (352)
T PRK12289        175 TVVAGPSGVGKSSLINR  191 (352)
T ss_pred             EEEEeCCCCCHHHHHHH
Confidence            68999999999999986

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=96.62  E-value=0.0019  Score=42.78  Aligned_cols=20  Identities=30%  Similarity=0.267  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-.++++|++|||||+++.+
T Consensus       137 g~ii~lvGptGvGKTTtiak  156 (374)
T PRK14722        137 GGVFALMGPTGVGKTTTTAK  156 (374)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            34678999999999999987

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)

Probab=96.62  E-value=0.002  Score=38.95  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (228)
T cd03257          33 TLGLVGESGSGKSTLARA   50 (228)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit

Probab=96.61  E-value=0.0018  Score=38.30  Aligned_cols=18  Identities=22%  Similarity=0.436  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        20 ~~~i~G~nGsGKSTLl~~   37 (190)
T TIGR01166        20 VLALLGANGAGKSTLLLH   37 (190)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=96.61  E-value=0.002  Score=39.29  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (235)
T cd03261          28 ILAIIGPSGSGKSTLLRL   45 (235)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974

The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group

Probab=96.60  E-value=0.0021  Score=38.34  Aligned_cols=18  Identities=22%  Similarity=0.556  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~i~G~nGsGKSTLl~~   43 (206)
T TIGR03608        26 MYAIIGESGSGKSTLLNI   43 (206)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively

Probab=96.60  E-value=0.0021  Score=38.54  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (213)
T cd03262          28 VVVIIGPSGSGKSTLLRC   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids

Probab=96.60  E-value=0.0021  Score=38.36  Aligned_cols=18  Identities=28%  Similarity=0.329  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (177)
T cd03222          27 VIGIVGPNGTGKTTAVKI   44 (177)
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            578999999999999973

RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK06893 DNA replication initiation factor; Validated

Probab=96.58  E-value=0.0019  Score=39.68  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+|+..
T Consensus        41 ~l~l~G~~G~GKThL~~a   58 (229)
T PRK06893         41 FFYIWGGKSSGKSHLLKA   58 (229)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            478899999999999974

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient

Probab=96.58  E-value=0.0022  Score=38.89  Aligned_cols=18  Identities=22%  Similarity=0.460  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (227)
T cd03260          28 ITALIGPSGCGKSTLLRL   45 (227)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup

Probab=96.58  E-value=0.0022  Score=38.53  Aligned_cols=18  Identities=28%  Similarity=0.414  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (213)
T cd03259          28 FLALLGPSGCGKTTLLRL   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR02673 FtsE cell division ATP-binding protein FtsE

Probab=96.58  E-value=0.0022  Score=38.49  Aligned_cols=18  Identities=28%  Similarity=0.372  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (214)
T TIGR02673        30 FLFLTGPSGAGKTTLLKL   47 (214)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin

Probab=96.57  E-value=0.0022  Score=38.74  Aligned_cols=18  Identities=28%  Similarity=0.292  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (220)
T cd03265          28 IFGLLGPNGAGKTTTIKM   45 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda

Probab=96.57  E-value=0.0021  Score=38.67  Aligned_cols=19  Identities=26%  Similarity=0.357  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        39 ~~lll~G~~G~GKT~la~~   57 (226)
T TIGR03420        39 RFLYLWGESGSGKSHLLQA   57 (226)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.

>PRK09563 rbgA GTPase YlqF; Reviewed

Probab=96.57  E-value=0.0052  Score=38.96  Aligned_cols=21  Identities=29%  Similarity=0.572  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.++|||||++.+
T Consensus       120 ~~~~~~~~G~pnvGKSsliN~  140 (287)
T PRK09563        120 RAIRAMIIGIPNVGKSTLINR  140 (287)
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            457899999999999999985

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters

Probab=96.57  E-value=0.0022  Score=38.51  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (213)
T cd03235          27 FLAIVGPNGAGKSTLLKA   44 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.

>PRK05057 aroK shikimate kinase I; Reviewed

Probab=96.55  E-value=0.0025  Score=37.63  Aligned_cols=19  Identities=21%  Similarity=0.281  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++...
T Consensus         5 ~~I~liG~~GaGKStl~~~   23 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGRQ   23 (172)
T ss_pred             CEEEEECCCCcCHHHHHHH
Confidence            3699999999999999985

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily

Probab=96.55  E-value=0.0022  Score=37.43  Aligned_cols=18  Identities=22%  Similarity=0.226  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++.+
T Consensus         5 ii~i~G~~GsGKsTl~~~   22 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQCEK   22 (188)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999975

Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake

Probab=96.55  E-value=0.0023  Score=38.52  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (218)
T cd03266          33 VTGLLGPNGAGKTTTLRM   50 (218)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein

Probab=96.55  E-value=0.0023  Score=38.59  Aligned_cols=18  Identities=28%  Similarity=0.519  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (221)
T TIGR02211        33 IVAIVGSSGSGKSTLLHL   50 (221)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.

>PRK03839 putative kinase; Provisional

Probab=96.55  E-value=0.0024  Score=37.49  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|.+|+|||++..+
T Consensus         2 ~I~l~G~pGsGKsT~~~~   19 (180)
T PRK03839          2 IIAITGTPGVGKTTVSKL   19 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            589999999999999975

>PF13479 AAA_24: AAA domain

Probab=96.54  E-value=0.0026  Score=38.65  Aligned_cols=20  Identities=30%  Similarity=0.486  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++-|++|+|||+++..
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~   22 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAAS   22 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHh
Confidence            47999999999999999985

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively

Probab=96.54  E-value=0.0024  Score=38.59  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (220)
T cd03293          32 FVALVGPSGCGKSTLLRI   49 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine

Probab=96.54  E-value=0.0023  Score=38.91  Aligned_cols=18  Identities=28%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (236)
T cd03219          28 IHGLIGPNGAGKTTLFNL   45 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system

Probab=96.53  E-value=0.0024  Score=38.94  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (241)
T cd03256          29 FVALIGPSGAGKSTLLRC   46 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974

Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids

Probab=96.53  E-value=0.0024  Score=38.78  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (232)
T cd03218          28 IVGLLGPNGAGKTTTFYM   45 (232)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.

>PRK09183 transposase/IS protein; Provisional

Probab=96.52  E-value=0.0021  Score=40.37  Aligned_cols=19  Identities=42%  Similarity=0.588  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+|+..
T Consensus       103 ~~v~l~Gp~GtGKThLa~a  121 (259)
T PRK09183        103 ENIVLLGPSGVGKTHLAIA  121 (259)
T ss_pred             CeEEEEeCCCCCHHHHHHH
Confidence            4688999999999999975

>TIGR01978 sufC FeS assembly ATPase SufC

Probab=96.52  E-value=0.0024  Score=38.94  Aligned_cols=18  Identities=22%  Similarity=0.342  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (243)
T TIGR01978        28 IHAIMGPNGSGKSTLSKT   45 (243)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.

>PRK14530 adenylate kinase; Provisional

Probab=96.51  E-value=0.0026  Score=38.47  Aligned_cols=18  Identities=17%  Similarity=0.351  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||++..+
T Consensus         5 ~I~i~G~pGsGKsT~~~~   22 (215)
T PRK14530          5 RILLLGAPGAGKGTQSSN   22 (215)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999985

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=96.51  E-value=0.0024  Score=42.85  Aligned_cols=20  Identities=30%  Similarity=0.297  Sum_probs=17.8

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++.++|++|+|||+++.+
T Consensus       191 g~vi~lvGpnG~GKTTtlak  210 (420)
T PRK14721        191 GGVYALIGPTGVGKTTTTAK  210 (420)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            35789999999999999986

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit

Probab=96.51  E-value=0.0023  Score=43.23  Aligned_cols=19  Identities=21%  Similarity=0.501  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -++.++|++|+|||+|+.-
T Consensus       362 ~~vaIvG~SGsGKSTLl~l  380 (529)
T TIGR02868       362 ERVAILGPSGSGKSTLLML  380 (529)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3678999999999999973

The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2

Probab=96.51  E-value=0.0025  Score=37.94  Aligned_cols=17  Identities=24%  Similarity=0.327  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.+.|++|+|||+++..
T Consensus         2 igi~G~~GsGKSTl~~~   18 (198)
T cd02023           2 IGIAGGSGSGKTTVAEE   18 (198)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.

>TIGR00064 ftsY signal recognition particle-docking protein FtsY

Probab=96.50  E-value=0.0028  Score=40.12  Aligned_cols=19  Identities=37%  Similarity=0.410  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++.+
T Consensus        73 ~vi~l~G~~G~GKTTt~ak   91 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTIAK   91 (272)
T ss_pred             eEEEEECCCCCcHHHHHHH
Confidence            5677889999999999986

There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds

Probab=96.50  E-value=0.0026  Score=38.32  Aligned_cols=18  Identities=22%  Similarity=0.290  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (220)
T cd03263          30 IFGLLGHNGAGKTTTLKM   47 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional

Probab=96.50  E-value=0.0025  Score=38.62  Aligned_cols=18  Identities=22%  Similarity=0.243  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        15 ~~~l~G~NGsGKSTLlk~   32 (213)
T PRK15177         15 HIGILAAPGSGKTTLTRL   32 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional

Probab=96.50  E-value=0.0026  Score=38.81  Aligned_cols=18  Identities=28%  Similarity=0.516  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~l~G~nGsGKSTLl~~   54 (233)
T PRK11629         37 MMAIVGSSGSGKSTLLHL   54 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>PRK08084 DNA replication initiation factor; Provisional

Probab=96.49  E-value=0.0025  Score=39.27  Aligned_cols=19  Identities=16%  Similarity=0.204  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus        46 ~~l~l~Gp~G~GKThLl~a   64 (235)
T PRK08084         46 GYIYLWSREGAGRSHLLHA   64 (235)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3688999999999999974

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK

Probab=96.49  E-value=0.0027  Score=38.09  Aligned_cols=18  Identities=28%  Similarity=0.414  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (213)
T cd03301          28 FVVLLGPSGCGKTTTLRM   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional

Probab=96.49  E-value=0.0026  Score=39.53  Aligned_cols=18  Identities=39%  Similarity=0.534  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (255)
T PRK11248         29 LLVVLGPSGCGKTTLLNL   46 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional

Probab=96.48  E-value=0.0027  Score=39.69  Aligned_cols=18  Identities=33%  Similarity=0.490  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        40 ~~~I~G~NGsGKSTLlk~   57 (257)
T PRK11247         40 FVAVVGRSGCGKSTLLRL   57 (257)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars

Probab=96.46  E-value=0.0033  Score=31.89  Aligned_cols=17  Identities=18%  Similarity=0.368  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.+.|++|+|||++..+
T Consensus         2 i~i~G~~gsGKst~~~~   18 (69)
T cd02019           2 IAITGGSGSGKSTVAKK   18 (69)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57889999999999985

Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.

>PRK00098 GTPase RsgA; Reviewed

Probab=96.46  E-value=0.0025  Score=40.64  Aligned_cols=18  Identities=39%  Similarity=0.639  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|||||||+..
T Consensus       166 ~~~~~G~sgvGKStlin~  183 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLNA  183 (298)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999985

>PRK13949 shikimate kinase; Provisional

Probab=96.46  E-value=0.0029  Score=37.30  Aligned_cols=18  Identities=39%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.|+|||++...
T Consensus         3 ~I~liG~~GsGKstl~~~   20 (169)
T PRK13949          3 RIFLVGYMGAGKTTLGKA   20 (169)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999974

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE

Probab=96.45  E-value=0.0029  Score=38.44  Aligned_cols=18  Identities=39%  Similarity=0.564  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (230)
T TIGR03410        28 VTCVLGRNGVGKTTLLKT   45 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport

Probab=96.45  E-value=0.0029  Score=38.51  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~l~G~nGsGKSTLl~~   50 (233)
T cd03258          33 IFGIIGRSGAGKSTLIRC   50 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=96.45  E-value=0.003  Score=36.78  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (163)
T cd03216          28 VHALLGENGAGKSTLMKI   45 (163)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>PRK14532 adenylate kinase; Provisional

Probab=96.45  E-value=0.0029  Score=37.29  Aligned_cols=18  Identities=22%  Similarity=0.289  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.|+|||++..+
T Consensus         2 ~i~~~G~pGsGKsT~a~~   19 (188)
T PRK14532          2 NLILFGPPAAGKGTQAKR   19 (188)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            689999999999999985

>PRK06526 transposase; Provisional

Probab=96.45  E-value=0.0023  Score=40.15  Aligned_cols=19  Identities=32%  Similarity=0.461  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+..
T Consensus        99 ~nlll~Gp~GtGKThLa~a  117 (254)
T PRK06526         99 ENVVFLGPPGTGKTHLAIG  117 (254)
T ss_pred             ceEEEEeCCCCchHHHHHH
Confidence            4789999999999999874

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance

Probab=96.45  E-value=0.0026  Score=38.07  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (208)
T cd03268          28 IYGFLGPNGAGKTTTMKI   45 (208)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.

>TIGR02881 spore_V_K stage V sporulation protein K

Probab=96.44  E-value=0.0032  Score=39.20  Aligned_cols=21  Identities=19%  Similarity=0.414  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++.|++|+|||+++..
T Consensus        41 ~~~~vll~GppGtGKTtlA~~   61 (261)
T TIGR02881        41 QVLHMIFKGNPGTGKTTVARI   61 (261)
T ss_pred             CcceEEEEcCCCCCHHHHHHH
Confidence            346789999999999999964

Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.

>cd01131 PilT Pilus retraction ATPase PilT

Probab=96.44  E-value=0.0028  Score=38.09  Aligned_cols=17  Identities=35%  Similarity=0.561  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus         4 ilI~GptGSGKTTll~~   20 (198)
T cd01131           4 VLVTGPTGSGKSTTLAA   20 (198)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999974

PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional

Probab=96.44  E-value=0.0029  Score=38.68  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLl~~   48 (241)
T PRK10895         31 IVGLLGPNGAGKTTTFYM   48 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK10908 cell division protein FtsE; Provisional

Probab=96.44  E-value=0.003  Score=38.20  Aligned_cols=18  Identities=22%  Similarity=0.445  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (222)
T PRK10908         30 MAFLTGHSGAGKSTLLKL   47 (222)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional

Probab=96.44  E-value=0.0023  Score=43.16  Aligned_cols=19  Identities=37%  Similarity=0.391  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++.+
T Consensus       224 ~vi~lvGptGvGKTTtaaK  242 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSIAK  242 (432)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4578999999999999987

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.43  E-value=0.003  Score=37.72  Aligned_cols=18  Identities=28%  Similarity=0.327  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (200)
T PRK13540         29 LLHLKGSNGAGKTTLLKL   46 (200)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system

Probab=96.43  E-value=0.003  Score=38.56  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (236)
T TIGR03864        29 FVALLGPNGAGKSTLFSL   46 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.

>PRK09087 hypothetical protein; Validated

Probab=96.42  E-value=0.0027  Score=39.11  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|++.
T Consensus        46 ~l~l~G~~GsGKThLl~~   63 (226)
T PRK09087         46 VVVLAGPVGSGKTHLASI   63 (226)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            378999999999999985

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters

Probab=96.42  E-value=0.0031  Score=37.87  Aligned_cols=18  Identities=28%  Similarity=0.427  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (202)
T cd03233          35 MVLVLGRPGSGCSTLLKA   52 (202)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG0218 Predicted GTPase [General function prediction only]

Probab=96.42  E-value=0.0032  Score=38.64  Aligned_cols=24  Identities=38%  Similarity=0.623  Sum_probs=20.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.+....|+++|.|.|||||++..
T Consensus        20 P~~~~~EIaF~GRSNVGKSSlIN~   43 (200)
T COG0218          20 PEDDLPEIAFAGRSNVGKSSLINA   43 (200)
T ss_pred             CCCCCcEEEEEccCcccHHHHHHH
Confidence            334557899999999999999985

>PRK08181 transposase; Validated

Probab=96.41  E-value=0.0025  Score=40.42  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus       107 ~nlll~Gp~GtGKTHLa~A  125 (269)
T PRK08181        107 ANLLLFGPPGGGKSHLAAA  125 (269)
T ss_pred             ceEEEEecCCCcHHHHHHH
Confidence            4699999999999999975

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea

Probab=96.41  E-value=0.0033  Score=37.05  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKStLl~~   44 (180)
T cd03214          27 IVGILGPNGAGKSTLLKT   44 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            577999999999999973

Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB

Probab=96.41  E-value=0.0031  Score=37.93  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+.-
T Consensus        24 e~~~i~G~nGsGKSTLl~~   42 (214)
T cd03297          24 EVTGIFGASGAGKSTLLRC   42 (214)
T ss_pred             eeEEEECCCCCCHHHHHHH
Confidence            3578999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor

Probab=96.41  E-value=0.0031  Score=39.17  Aligned_cols=18  Identities=28%  Similarity=0.434  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~i~G~NGsGKSTLlk~   44 (246)
T cd03237          27 VIGILGPNGIGKTTFIKM   44 (246)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment

Probab=96.41  E-value=0.0033  Score=36.96  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (178)
T cd03229          28 IVALLGPSGSGKSTLLRC   45 (178)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA

Probab=96.40  E-value=0.0033  Score=37.47  Aligned_cols=18  Identities=33%  Similarity=0.481  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (198)
T TIGR01189        28 ALQVTGPNGIGKTTLLRI   45 (198)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.

>PRK08903 DnaA regulatory inactivator Hda; Validated

Probab=96.40  E-value=0.0028  Score=38.45  Aligned_cols=18  Identities=22%  Similarity=0.401  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|+..
T Consensus        44 ~~~l~G~~G~GKT~La~a   61 (227)
T PRK08903         44 FFYLWGEAGSGRSHLLQA   61 (227)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999975

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import

Probab=96.40  E-value=0.0032  Score=38.52  Aligned_cols=18  Identities=28%  Similarity=0.446  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (239)
T cd03296          30 LVALLGPSGSGKTTLLRL   47 (239)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP

Probab=96.40  E-value=0.0033  Score=37.72  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~l~G~nGsGKSTLl~~   43 (211)
T cd03298          26 ITAIVGPSGSGKSTLLNL   43 (211)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity

Probab=96.39  E-value=0.0035  Score=36.73  Aligned_cols=18  Identities=33%  Similarity=0.394  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (173)
T cd03230          28 IYGLLGPNGAGKTTLIKI   45 (173)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973

In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.38  E-value=0.0032  Score=39.30  Aligned_cols=18  Identities=28%  Similarity=0.407  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (271)
T PRK13638         29 VTGLVGANGCGKSTLFMN   46 (271)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973

>PRK14242 phosphate transporter ATP-binding protein; Provisional

Probab=96.38  E-value=0.0033  Score=38.71  Aligned_cols=18  Identities=17%  Similarity=0.462  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (253)
T PRK14242         34 VTALIGPSGCGKSTFLRC   51 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.38  E-value=0.0034  Score=37.38  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (195)
T PRK13541         28 ITYIKGANGCGKSSLLRM   45 (195)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            568999999999999974

>cd01120 RecA-like_NTPases RecA-like NTPases

Probab=96.38  E-value=0.0032  Score=35.32  Aligned_cols=17  Identities=41%  Similarity=0.505  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus         2 ~~i~G~~G~GKT~l~~~   18 (165)
T cd01120           2 ILVFGPTGSGKTTLALQ   18 (165)
T ss_pred             eeEeCCCCCCHHHHHHH
Confidence            57889999999999975

This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=96.38  E-value=0.0029  Score=38.65  Aligned_cols=18  Identities=39%  Similarity=0.608  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|++|+|||+|+..
T Consensus        25 ~~~i~GpNGsGKStll~a   42 (243)
T cd03272          25 HNVVVGRNGSGKSNFFAA   42 (243)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            457889999999999975

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional

Probab=96.38  E-value=0.0034  Score=38.08  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        38 ~~~i~G~nGsGKSTLl~~   55 (228)
T PRK10584         38 TIALIGESGSGKSTLLAI   55 (228)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>PRK02496 adk adenylate kinase; Provisional

Probab=96.38  E-value=0.004  Score=36.65  Aligned_cols=19  Identities=16%  Similarity=0.335  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++...
T Consensus         2 ~~i~i~G~pGsGKst~a~~   20 (184)
T PRK02496          2 TRLIFLGPPGAGKGTQAVV   20 (184)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5799999999999999874

>PRK08233 hypothetical protein; Provisional

Probab=96.38  E-value=0.0041  Score=36.11  Aligned_cols=19  Identities=21%  Similarity=0.116  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +-|.+.|.+|+|||+++.+
T Consensus         4 ~iI~I~G~~GsGKtTla~~   22 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTER   22 (182)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5677889999999999985

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional

Probab=96.37  E-value=0.0034  Score=38.45  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (242)
T PRK11124         30 TLVLLGPSGAGKSSLLRV   47 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional

Probab=96.37  E-value=0.0034  Score=38.17  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (225)
T PRK10247         35 FKLITGPSGCGKSTLLKI   52 (225)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK

Probab=96.37  E-value=0.0033  Score=38.69  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (253)
T TIGR02323        31 VLGIVGESGSGKSTLLGC   48 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function

Probab=96.37  E-value=0.003  Score=38.02  Aligned_cols=18  Identities=33%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        24 ~~~i~G~nGsGKStll~a   41 (197)
T cd03278          24 LTAIVGPNGSGKSNIIDA   41 (197)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            467899999999999975

Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=96.37  E-value=0.0032  Score=38.92  Aligned_cols=18  Identities=22%  Similarity=0.318  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|++|+|||+|+..
T Consensus        27 ~~~IvG~NGsGKStll~A   44 (251)
T cd03273          27 FNAITGLNGSGKSNILDA   44 (251)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            356889999999999975

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters

Probab=96.37  E-value=0.0035  Score=37.30  Aligned_cols=18  Identities=28%  Similarity=0.521  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (192)
T cd03232          35 LTALMGESGAGKTTLLDV   52 (192)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK08727 hypothetical protein; Validated

Probab=96.36  E-value=0.0031  Score=38.87  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+|+..
T Consensus        44 l~l~G~~G~GKThL~~a   60 (233)
T PRK08727         44 LYLSGPAGTGKTHLALA   60 (233)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            88999999999999975

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.36  E-value=0.0035  Score=38.56  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14247         31 ITALMGPSGSGKSTLLRV   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]

Probab=96.36  E-value=0.0029  Score=38.57  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++||+|.|||+|++-
T Consensus        30 tlvllgpsgagkssllr~   47 (242)
T COG4161          30 TLVLLGPSGAGKSSLLRV   47 (242)
T ss_pred             EEEEECCCCCchHHHHHH
Confidence            478999999999999963

>cd01849 YlqF_related_GTPase YlqF-related GTPases

Probab=96.36  E-value=0.01  Score=34.14  Aligned_cols=21  Identities=33%  Similarity=0.477  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|.++||||+++..
T Consensus        99 ~~~~~~~~G~~~~GKstlin~  119 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINA  119 (155)
T ss_pred             cCcEEEEEccCCCCHHHHHHH
Confidence            346789999999999999984

These proteins are found in bacteria, eukaryotes, and archaea. They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.

>PRK05642 DNA replication initiation factor; Validated

Probab=96.35  E-value=0.0031  Score=38.91  Aligned_cols=19  Identities=26%  Similarity=0.407  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+|+..
T Consensus        46 ~~l~l~G~~G~GKTHLl~a   64 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQA   64 (234)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3567889999999999874

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.35  E-value=0.0036  Score=37.51  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (204)
T PRK13538         29 LVQIEGPNGAGKTSLLRI   46 (204)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.35  E-value=0.0036  Score=37.63  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (207)
T PRK13539         30 ALVLTGPNGSGKTTLLRL   47 (207)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>PRK00093 GTP-binding protein Der; Reviewed

Probab=96.35  E-value=0.015  Score=38.45  Aligned_cols=21  Identities=43%  Similarity=0.667  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.++|.+++|||||+.+
T Consensus       172 ~~~~v~ivG~~n~GKStlin~  192 (435)
T PRK00093        172 EPIKIAIIGRPNVGKSSLINA  192 (435)
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            468999999999999999986

>TIGR00475 selB selenocysteine-specific elongation factor SelB

Probab=96.35  E-value=0.008  Score=41.69  Aligned_cols=18  Identities=33%  Similarity=0.375  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|..++|||||+.+
T Consensus         2 ~I~iiG~~d~GKTTLi~a   19 (581)
T TIGR00475         2 IIATAGHVDHGKTTLLKA   19 (581)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999996

In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes.

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]

Probab=96.35  E-value=0.0064  Score=36.59  Aligned_cols=21  Identities=33%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|+.+-|+.|||||+++.+
T Consensus         4 ~~mki~ITG~PGvGKtTl~~k   24 (179)
T COG1618           4 MAMKIFITGRPGVGKTTLVLK   24 (179)
T ss_pred             cceEEEEeCCCCccHHHHHHH
Confidence            457999999999999999987

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein

Probab=96.35  E-value=0.0036  Score=37.93  Aligned_cols=18  Identities=44%  Similarity=0.608  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (229)
T cd03254          31 TVAIVGPTGAGKTTLINL   48 (229)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            368999999999999974

In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases

Probab=96.34  E-value=0.0037  Score=37.13  Aligned_cols=19  Identities=37%  Similarity=0.529  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        26 ~~i~I~G~tGSGKTTll~a   44 (186)
T cd01130          26 KNILISGGTGSGKTTLLNA   44 (186)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4689999999999999974

The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.

>PRK14974 cell division protein FtsY; Provisional

Probab=96.34  E-value=0.0032  Score=41.11  Aligned_cols=20  Identities=40%  Similarity=0.414  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|++|+|||+++.+
T Consensus       140 ~~vi~~~G~~GvGKTTtiak  159 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTIAK  159 (336)
T ss_pred             CeEEEEEcCCCCCHHHHHHH
Confidence            46789999999999998875

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3

Probab=96.34  E-value=0.0029  Score=43.39  Aligned_cols=17  Identities=18%  Similarity=0.438  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      -+.++|++|+|||+|+.
T Consensus        34 iv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        34 LLFLCGSSGDGKSEILA   50 (504)
T ss_pred             EEEEECCCCCCHHHHHh
Confidence            47899999999999997

cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.

>PRK06620 hypothetical protein; Validated

Probab=96.34  E-value=0.0032  Score=38.51  Aligned_cols=19  Identities=26%  Similarity=0.347  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus        45 ~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            3578999999999999974

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis

Probab=96.34  E-value=0.0038  Score=36.65  Aligned_cols=18  Identities=28%  Similarity=0.508  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKStLl~~   47 (178)
T cd03247          30 KIALLGRSGSGKSTLLQL   47 (178)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.

>PRK13851 type IV secretion system protein VirB11; Provisional

Probab=96.34  E-value=0.0041  Score=40.76  Aligned_cols=20  Identities=25%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++.|++|+|||+++..
T Consensus       162 ~~nilI~G~tGSGKTTll~a  181 (344)
T PRK13851        162 RLTMLLCGPTGSGKTTMSKT  181 (344)
T ss_pred             CCeEEEECCCCccHHHHHHH
Confidence            46799999999999999975

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome

Probab=96.33  E-value=0.0039  Score=36.41  Aligned_cols=18  Identities=28%  Similarity=0.562  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (166)
T cd03223          29 RLLITGPSGTGKSSLFRA   46 (166)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]

Probab=96.33  E-value=0.0079  Score=37.35  Aligned_cols=22  Identities=18%  Similarity=0.342  Sum_probs=18.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+-|-+-|++|+|||+++.+
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~   27 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKE   27 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHH
Confidence            4456778889999999999985

>PRK14239 phosphate transporter ATP-binding protein; Provisional

Probab=96.32  E-value=0.0037  Score=38.42  Aligned_cols=18  Identities=22%  Similarity=0.484  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (252)
T PRK14239         33 ITALIGPSGSGKSTLLRS   50 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D

Probab=96.32  E-value=0.0038  Score=38.14  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        13 ~~~i~G~nGsGKSTLl~~   30 (230)
T TIGR01184        13 FISLIGHSGCGKSTLLNL   30 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]

Probab=96.32  E-value=0.004  Score=39.45  Aligned_cols=18  Identities=33%  Similarity=0.562  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHh
Q psy15257         13 VKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~   30 (65)
                      -+.+++|++|.|||+|+.
T Consensus        58 e~W~I~G~NGsGKTTLL~   75 (257)
T COG1119          58 EHWAIVGPNGAGKTTLLS   75 (257)
T ss_pred             CcEEEECCCCCCHHHHHH
Confidence            357899999999999997

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E

Probab=96.32  E-value=0.0038  Score=38.06  Aligned_cols=18  Identities=28%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (237)
T cd03252          30 VVGIVGRSGSGKSTLTKL   47 (237)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=96.32  E-value=0.0039  Score=36.76  Aligned_cols=18  Identities=28%  Similarity=0.230  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (182)
T cd03215          28 IVGIAGLVGNGQTELAEA   45 (182)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.32  E-value=0.0037  Score=39.16  Aligned_cols=18  Identities=22%  Similarity=0.418  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (280)
T PRK13649         35 YTAFIGHTGSGKSTIMQL   52 (280)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.31  E-value=0.0038  Score=38.51  Aligned_cols=18  Identities=17%  Similarity=0.457  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (254)
T PRK14273         35 ITALIGPSGCGKSTFLRT   52 (254)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>cd01854 YjeQ_engC YjeQ/EngC

Probab=96.31  E-value=0.0039  Score=39.58  Aligned_cols=19  Identities=47%  Similarity=0.697  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||||+..
T Consensus       162 k~~~~~G~sg~GKSTlin~  180 (287)
T cd01854         162 KTSVLVGQSGVGKSTLINA  180 (287)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4688999999999999985

YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional

Probab=96.31  E-value=0.0039  Score=38.30  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK11264         31 VVAIIGPSGSGKTTLLRC   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional

Probab=96.31  E-value=0.0033  Score=41.14  Aligned_cols=17  Identities=35%  Similarity=0.597  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        33 ~~llG~sGsGKSTLLr~   49 (356)
T PRK11650         33 IVLVGPSGCGKSTLLRM   49 (356)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67999999999999974

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional

Probab=96.30  E-value=0.0033  Score=41.08  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~llGpsGsGKSTLLr~   51 (351)
T PRK11432         34 MVTLLGPSGCGKTTVLRL   51 (351)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            368899999999999973

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.30  E-value=0.0035  Score=38.62  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~nGsGKSTLl~~   49 (253)
T PRK14267         32 VFALMGPSGCGKSTLLRT   49 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]

Probab=96.30  E-value=0.0034  Score=43.46  Aligned_cols=19  Identities=26%  Similarity=0.490  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|.+|+|||+++.-
T Consensus       365 EkvAIlG~SGsGKSTllqL  383 (573)
T COG4987         365 EKVAILGRSGSGKSTLLQL  383 (573)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            5799999999999999973

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment

Probab=96.30  E-value=0.004  Score=38.17  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (242)
T cd03295          29 FLVLIGPSGSGKTTTMKM   46 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.29  E-value=0.0039  Score=39.32  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~l~G~nGsGKSTLl~~   56 (289)
T PRK13645         39 VTCVIGTTGSGKSTMIQL   56 (289)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters

Probab=96.29  E-value=0.0041  Score=37.48  Aligned_cols=18  Identities=28%  Similarity=0.541  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (220)
T cd03245          32 KVAIIGRVGSGKSTLLKL   49 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.

>PRK06547 hypothetical protein; Provisional

Probab=96.29  E-value=0.005  Score=36.58  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=17.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||++...
T Consensus        14 ~~~~i~i~G~~GsGKTt~a~~   34 (172)
T PRK06547         14 GMITVLIDGRSGSGKTTLAGA   34 (172)
T ss_pred             CCEEEEEECCCCCCHHHHHHH
Confidence            346788889999999999975

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.28  E-value=0.0041  Score=38.20  Aligned_cols=18  Identities=33%  Similarity=0.501  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (241)
T PRK14250         31 IYTIVGPSGAGKSTLIKL   48 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes

Probab=96.28  E-value=0.0036  Score=37.83  Aligned_cols=18  Identities=17%  Similarity=0.425  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus        27 ~~~ltGpNg~GKSTllr~   44 (199)
T cd03283          27 GILITGSNMSGKSTFLRT   44 (199)
T ss_pred             EEEEECCCCCChHHHHHH
Confidence            468899999999999964

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain

Probab=96.28  E-value=0.0043  Score=36.34  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKStLl~~   47 (173)
T cd03246          30 SLAIIGPSGSGKSTLARL   47 (173)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)

Probab=96.28  E-value=0.0032  Score=34.41  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |.+-|++|+|||.++..
T Consensus         1 I~i~G~~G~GKS~l~~~   17 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAKE   17 (107)
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            46789999999999985

All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below: Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein. The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated

Probab=96.28  E-value=0.0034  Score=42.84  Aligned_cols=19  Identities=32%  Similarity=0.358  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|||||+++.+
T Consensus       257 ~Vi~LvGpnGvGKTTTiaK  275 (484)
T PRK06995        257 GVFALMGPTGVGKTTTTAK  275 (484)
T ss_pred             cEEEEECCCCccHHHHHHH
Confidence            4678999999999999986

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional

Probab=96.28  E-value=0.0041  Score=38.47  Aligned_cols=18  Identities=28%  Similarity=0.361  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLl~~   48 (254)
T PRK10418         31 VLALVGGSGSGKSLTCAA   48 (254)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth

Probab=96.27  E-value=0.004  Score=35.68  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (144)
T cd03221          28 RIGLVGRNGAGKSTLLKL   45 (144)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973

EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.

>CHL00131 ycf16 sulfate ABC transporter protein; Validated

Probab=96.27  E-value=0.0042  Score=38.20  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        35 ~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         35 IHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57799999999999997

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake

Probab=96.27  E-value=0.0042  Score=38.07  Aligned_cols=18  Identities=22%  Similarity=0.276  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        49 ~~~i~G~NGsGKSTLl~~   66 (236)
T cd03267          49 IVGFIGPNGAGKTTTLKI   66 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.27  E-value=0.0041  Score=38.50  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        40 ~~~l~G~nGsGKSTLl~~   57 (259)
T PRK14274         40 VTAIIGPSGCGKSTFIKT   57 (259)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=96.27  E-value=0.0034  Score=38.44  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.4

Q ss_pred             EEEEECCCCChHHHHH
Q psy15257         14 KCVVVGDTAVGKTRLI   29 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~   29 (65)
                      -+.++|++|+|||+|+
T Consensus        23 ~~~l~G~sGsGKSTL~   38 (226)
T cd03270          23 LVVITGVSGSGKSSLA   38 (226)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            4678999999999997

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional

Probab=96.27  E-value=0.0042  Score=38.55  Aligned_cols=18  Identities=22%  Similarity=0.469  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~i~G~nGsGKSTLl~~   58 (260)
T PRK10744         41 VTAFIGPSGCGKSTLLRT   58 (260)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.26  E-value=0.0041  Score=37.55  Aligned_cols=18  Identities=39%  Similarity=0.575  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (214)
T PRK13543         39 ALLVQGDNGAGKTTLLRV   56 (214)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974

>TIGR01425 SRP54_euk signal recognition particle protein SRP54

Probab=96.26  E-value=0.0037  Score=42.11  Aligned_cols=20  Identities=25%  Similarity=0.159  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|.+|+|||+++.+
T Consensus       100 ~~vi~lvG~~GvGKTTtaaK  119 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTCTK  119 (429)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            35688999999999999986

This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.

>PRK14241 phosphate transporter ATP-binding protein; Provisional

Probab=96.26  E-value=0.0042  Score=38.45  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (258)
T PRK14241         32 VTAFIGPSGCGKSTVLRT   49 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD

Probab=96.26  E-value=0.0042  Score=37.95  Aligned_cols=18  Identities=28%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (242)
T TIGR03411        30 LRVIIGPNGAGKTTMMDV   47 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.26  E-value=0.0043  Score=38.16  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14262         31 ITAIIGPSGCGKTTLLRS   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]

Probab=96.26  E-value=0.0025  Score=41.83  Aligned_cols=44  Identities=23%  Similarity=0.190  Sum_probs=28.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ...+-++++|-+|+|||+.+.+      .........+..-+.+.|.||+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTIaK------LA~~l~~~g~~VllaA~DTFRA  180 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTIAK------LAKYLKQQGKSVLLAAGDTFRA  180 (340)
T ss_pred             CCcEEEEEEecCCCchHhHHHH------HHHHHHHCCCeEEEEecchHHH
Confidence            3467899999999999999987      3333333334444444566553

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD

Probab=96.26  E-value=0.0043  Score=37.82  Aligned_cols=18  Identities=28%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        14 ~~~i~G~nGsGKSTLl~~   31 (230)
T TIGR02770        14 VLALVGESGSGKSLTCLA   31 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit

Probab=96.25  E-value=0.004  Score=39.23  Aligned_cols=18  Identities=28%  Similarity=0.429  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        32 ~~ll~Gp~G~GKT~la~~   49 (305)
T TIGR00635        32 HLLLYGPPGLGKTTLAHI   49 (305)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999975

RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional

Probab=96.25  E-value=0.0043  Score=38.66  Aligned_cols=18  Identities=22%  Similarity=0.387  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (265)
T PRK10575         39 VTGLIGHNGSGKSTLLKM   56 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>PRK13947 shikimate kinase; Provisional

Probab=96.25  E-value=0.0046  Score=35.77  Aligned_cols=18  Identities=28%  Similarity=0.298  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|.+|+|||++..+
T Consensus         3 ~I~l~G~~GsGKst~a~~   20 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKR   20 (171)
T ss_pred             eEEEEcCCCCCHHHHHHH
Confidence            689999999999999975

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed

Probab=96.25  E-value=0.0043  Score=37.99  Aligned_cols=17  Identities=24%  Similarity=0.423  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (248)
T PRK09580         29 VHAIMGPNGSGKSTLSA   45 (248)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999997

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors

Probab=96.25  E-value=0.0044  Score=37.63  Aligned_cols=18  Identities=33%  Similarity=0.530  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLlk~   52 (226)
T cd03234          35 VMAILGSSGSGKTTLLDA   52 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE

Probab=96.24  E-value=0.0043  Score=38.64  Aligned_cols=18  Identities=22%  Similarity=0.364  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (265)
T TIGR02769        39 TVGLLGRSGCGKSTLARL   56 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional

Probab=96.24  E-value=0.0042  Score=38.77  Aligned_cols=18  Identities=22%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~i~G~NGsGKSTLl~~   58 (267)
T PRK15112         41 TLAIIGENGSGKSTLAKM   58 (267)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria

Probab=96.24  E-value=0.0043  Score=36.38  Aligned_cols=19  Identities=21%  Similarity=0.550  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .=+++.|++|+|||++...
T Consensus        15 ~gvLi~G~sG~GKStlal~   33 (149)
T cd01918          15 IGVLITGPSGIGKSELALE   33 (149)
T ss_pred             EEEEEEcCCCCCHHHHHHH
Confidence            3578999999999999875

It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions. The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional

Probab=96.24  E-value=0.0043  Score=38.80  Aligned_cols=18  Identities=33%  Similarity=0.429  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (272)
T PRK15056         35 IAALVGVNGSGKSTLFKA   52 (272)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export

Probab=96.24  E-value=0.0044  Score=37.75  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        50 ~~~i~G~nGsGKSTLl~~   67 (224)
T cd03220          50 RIGLIGRNGAGKSTLLRL   67 (224)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional

Probab=96.24  E-value=0.0043  Score=38.39  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (258)
T PRK11701         34 VLGIVGESGSGKTTLLNA   51 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter

Probab=96.24  E-value=0.0045  Score=37.04  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (201)
T cd03231          28 ALQVTGPNGSGKTTLLRI   45 (201)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains

Probab=96.23  E-value=0.0038  Score=37.76  Aligned_cols=18  Identities=39%  Similarity=0.604  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        24 ~~~i~G~NGsGKTTLl~a   41 (204)
T cd03240          24 LTLIVGQNGAGKTTIIEA   41 (204)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            568889999999999974

The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=96.23  E-value=0.0044  Score=38.14  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~l~G~nGsGKSTLl~~   50 (255)
T PRK11300         33 IVSLIGPNGAGKTTVFNC   50 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein

Probab=96.23  E-value=0.0045  Score=38.16  Aligned_cols=18  Identities=22%  Similarity=0.534  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (252)
T TIGR03005        28 KVALIGPSGSGKSTILRI   45 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]

Probab=96.22  E-value=0.0042  Score=38.00  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.+.||+|+|||+|+..
T Consensus        31 ~iaitGPSG~GKStllk~   48 (223)
T COG4619          31 FIAITGPSGCGKSTLLKI   48 (223)
T ss_pred             eEEEeCCCCccHHHHHHH
Confidence            467889999999999974

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated

Probab=96.22  E-value=0.0039  Score=41.74  Aligned_cols=18  Identities=39%  Similarity=0.549  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|||||+++.+
T Consensus       223 ~i~~vGptGvGKTTt~~k  240 (424)
T PRK05703        223 VVALVGPTGVGKTTTLAK  240 (424)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            678999999999999886

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional

Probab=96.22  E-value=0.0046  Score=37.02  Aligned_cols=19  Identities=21%  Similarity=0.193  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+.++|.+|+|||+|+.+
T Consensus         7 ~ii~ivG~sgsGKTTLi~~   25 (173)
T PRK10751          7 PLLAIAAWSGTGKTTLLKK   25 (173)
T ss_pred             eEEEEECCCCChHHHHHHH
Confidence            3578899999999999876

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase

Probab=96.22  E-value=0.0044  Score=38.89  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++.++|++|+|||+|+..
T Consensus        16 Gqr~~I~G~~G~GKTTLlr~   35 (249)
T cd01128          16 GQRGLIVAPPKAGKTTLLQS   35 (249)
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            34789999999999999974

It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional

Probab=96.22  E-value=0.0045  Score=38.66  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (269)
T PRK11831         35 ITAIMGPSGIGKTTLLRL   52 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)

Probab=96.21  E-value=0.0041  Score=36.51  Aligned_cols=18  Identities=17%  Similarity=0.279  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|+.|+|||++..+
T Consensus         1 ~I~i~G~pGsGKst~a~~   18 (194)
T cd01428           1 RILLLGPPGSGKGTQAER   18 (194)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            478999999999999975

This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.21  E-value=0.0046  Score=38.12  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (253)
T PRK14261         34 VTALIGPSGCGKSTLLRC   51 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL

Probab=96.21  E-value=0.0048  Score=37.32  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        36 ~~~l~G~nGsGKSTLl~~   53 (224)
T TIGR02324        36 CVALSGPSGAGKSTLLKS   53 (224)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.

>cd00880 Era_like Era (E

Probab=96.21  E-value=0.0025  Score=35.00  Aligned_cols=15  Identities=40%  Similarity=0.645  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+.|+|||+++.+
T Consensus         1 i~G~~gsGKstl~~~   15 (163)
T cd00880           1 LFGRTNAGKSSLLNA   15 (163)
T ss_pred             CcCCCCCCHHHHHHH
Confidence            479999999999986

coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed

Probab=96.21  E-value=0.0047  Score=38.40  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~I~G~NGsGKSTLl~~   49 (251)
T PRK09544         32 ILTLLGPNGAGKSTLVRV   49 (251)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif

Probab=96.20  E-value=0.0039  Score=37.17  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=16.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||.|+..
T Consensus        47 ~~~l~l~G~~G~GKThLa~a   66 (178)
T PF01695_consen   47 GENLILYGPPGTGKTHLAVA   66 (178)
T ss_dssp             --EEEEEESTTSSHHHHHHH
T ss_pred             CeEEEEEhhHhHHHHHHHHH
Confidence            35799999999999999875

They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor

Probab=96.20  E-value=0.0047  Score=38.64  Aligned_cols=18  Identities=22%  Similarity=0.331  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~IvG~nGsGKSTLlk~   45 (255)
T cd03236          28 VLGLVGPNGIGKSTALKI   45 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999974

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional

Probab=96.20  E-value=0.0047  Score=37.62  Aligned_cols=18  Identities=22%  Similarity=0.567  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (232)
T PRK10771         27 RVAILGPSGAGKSTLLNL   44 (232)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional

Probab=96.20  E-value=0.0045  Score=40.62  Aligned_cols=18  Identities=33%  Similarity=0.492  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLL~~   48 (369)
T PRK11000         31 FVVFVGPSGCGKSTLLRM   48 (369)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            468999999999999973

>PRK14531 adenylate kinase; Provisional

Probab=96.20  E-value=0.0052  Score=36.37  Aligned_cols=19  Identities=16%  Similarity=0.282  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++..+
T Consensus         3 ~~i~i~G~pGsGKsT~~~~   21 (183)
T PRK14531          3 QRLLFLGPPGAGKGTQAAR   21 (183)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4799999999999999875

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein

Probab=96.20  E-value=0.0042  Score=38.16  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (247)
T TIGR00972        29 VTALIGPSGCGKSTLLRS   46 (247)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.

>PLN02772 guanylate kinase

Probab=96.20  E-value=0.0055  Score=40.99  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++||+||||++|+.+
T Consensus       136 k~iVlsGPSGvGKsTL~~~  154 (398)
T PLN02772        136 KPIVISGPSGVGKGTLISM  154 (398)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3578889999999999985

>PRK12298 obgE GTPase CgtA; Reviewed

Probab=96.20  E-value=0.012  Score=39.04  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.+++|||||+.+
T Consensus       161 dValVG~PNaGKSTLln~  178 (390)
T PRK12298        161 DVGLLGLPNAGKSTFIRA  178 (390)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            578999999999999985

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.20  E-value=0.0042  Score=38.85  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~l~G~nGsGKSTLl~~   54 (271)
T PRK13632         37 YVAILGHNGSGKSTISKI   54 (271)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein

Probab=96.20  E-value=0.0045  Score=40.43  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~GpsGsGKSTLLr~   49 (353)
T TIGR03265        32 FVCLLGPSGCGKTTLLRI   49 (353)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.

>PRK14240 phosphate transporter ATP-binding protein; Provisional

Probab=96.20  E-value=0.0048  Score=37.93  Aligned_cols=18  Identities=17%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14240         31 VTALIGPSGCGKSTFLRT   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules

Probab=96.19  E-value=0.0049  Score=37.32  Aligned_cols=18  Identities=22%  Similarity=0.470  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        42 ~~~i~G~nGsGKSTLl~~   59 (226)
T cd03248          42 VTALVGPSGSGKSTVVAL   59 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974

Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate

Probab=96.19  E-value=0.0048  Score=35.03  Aligned_cols=17  Identities=35%  Similarity=0.393  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|.+|+|||++...
T Consensus         2 i~l~G~~GsGKST~a~~   18 (150)
T cd02021           2 IVVMGVSGSGKSTVGKA   18 (150)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            57889999999999985

The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea

Probab=96.19  E-value=0.0043  Score=38.82  Aligned_cols=18  Identities=28%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        52 ~~~l~G~nGsGKSTLl~~   69 (269)
T cd03294          52 IFVIMGLSGSGKSTLLRC   69 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.19  E-value=0.0048  Score=38.58  Aligned_cols=18  Identities=17%  Similarity=0.469  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~l~G~nGsGKSTLl~~   58 (269)
T PRK14259         41 VTALIGPSGCGKSTVLRS   58 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]

Probab=96.18  E-value=0.0046  Score=38.83  Aligned_cols=20  Identities=40%  Similarity=0.456  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||.|+..
T Consensus       105 ~~nl~l~G~~G~GKThLa~A  124 (254)
T COG1484         105 GENLVLLGPPGVGKTHLAIA  124 (254)
T ss_pred             CCcEEEECCCCCcHHHHHHH
Confidence            45789999999999999985

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional

Probab=96.18  E-value=0.0047  Score=40.21  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~l~G~nGsGKSTLl~~   43 (352)
T PRK11144         26 ITAIFGRSGAGKTSLINA   43 (352)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>PTZ00088 adenylate kinase 1; Provisional

Probab=96.18  E-value=0.0052  Score=38.11  Aligned_cols=19  Identities=32%  Similarity=0.447  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|++|+|||++..+
T Consensus         7 mrIvl~G~PGsGK~T~a~~   25 (229)
T PTZ00088          7 LKIVLFGAPGVGKGTFAEI   25 (229)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            6799999999999999985

>smart00053 DYNc Dynamin, GTPase

Probab=96.17  E-value=0.0048  Score=38.63  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=18.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|++|+||||++..
T Consensus        25 ~~p~i~vvG~~~~GKSt~l~~   45 (240)
T smart00053       25 DLPQIAVVGGQSAGKSSVLEN   45 (240)
T ss_pred             CCCeEEEEcCCCccHHHHHHH
Confidence            345799999999999999985

Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A

Probab=96.17  E-value=0.0035  Score=36.08  Aligned_cols=18  Identities=44%  Similarity=0.479  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|+.++|||+|+.+
T Consensus         2 vv~VvG~~~sGKTTl~~~   19 (140)
T PF03205_consen    2 VVQVVGPKNSGKTTLIRK   19 (140)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999985

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]

Probab=96.17  E-value=0.0054  Score=40.90  Aligned_cols=21  Identities=29%  Similarity=0.419  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++||+|||||-++.|
T Consensus        49 ~PKNILMIGpTGVGKTEIARR   69 (444)
T COG1220          49 TPKNILMIGPTGVGKTEIARR   69 (444)
T ss_pred             CccceEEECCCCCcHHHHHHH
Confidence            346799999999999999986

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI

Probab=96.17  E-value=0.0049  Score=39.19  Aligned_cols=18  Identities=17%  Similarity=0.259  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~NGaGKSTLl~~   49 (303)
T TIGR01288        32 CFGLLGPNGAGKSTIARM   49 (303)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]

Probab=96.17  E-value=0.0046  Score=37.33  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=14.3

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +-+.||+|||||+|+.
T Consensus        31 vtlMGPSGcGKSTLls   46 (213)
T COG4136          31 VTLMGPSGCGKSTLLS   46 (213)
T ss_pred             EEEECCCCccHHHHHH
Confidence            5688999999999996

>TIGR00150 HI0065_YjeE ATPase, YjeE family

Probab=96.16  E-value=0.0048  Score=35.53  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|+.|+|||++++.
T Consensus        24 ~i~l~G~lGaGKTtl~~~   41 (133)
T TIGR00150        24 VVLLKGDLGAGKTTLVQG   41 (133)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            578999999999999975

Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit

Probab=96.16  E-value=0.0052  Score=37.17  Aligned_cols=18  Identities=22%  Similarity=0.362  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (223)
T TIGR03740        28 VYGLLGPNGAGKSTLLKM   45 (223)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins

Probab=96.15  E-value=0.0052  Score=37.34  Aligned_cols=18  Identities=28%  Similarity=0.510  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (234)
T cd03251          30 TVALVGPSGSGKSTLVNL   47 (234)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed

Probab=96.15  E-value=0.0043  Score=40.90  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        42 ~~~LlGpsGsGKSTLLr~   59 (375)
T PRK09452         42 FLTLLGPSGCGKTTVLRL   59 (375)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999973

>cd01855 YqeH YqeH

Probab=96.15  E-value=0.0045  Score=36.61  Aligned_cols=19  Identities=53%  Similarity=0.606  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|.++||||+|+..
T Consensus       128 ~~~~~~G~~nvGKStliN~  146 (190)
T cd01855         128 GDVYVVGATNVGKSTLINA  146 (190)
T ss_pred             CcEEEEcCCCCCHHHHHHH
Confidence            4789999999999999985

YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts. Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends

Probab=96.15  E-value=0.005  Score=37.25  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+|+..
T Consensus        30 ~~~i~G~NGsGKSTll~~   47 (213)
T cd03279          30 LFLICGPTGAGKSTILDA   47 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.

>PRK09825 idnK D-gluconate kinase; Provisional

Probab=96.15  E-value=0.0048  Score=36.61  Aligned_cols=18  Identities=17%  Similarity=0.333  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         5 ~i~l~G~sGsGKSTl~~~   22 (176)
T PRK09825          5 SYILMGVSGSGKSLIGSK   22 (176)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468899999999999974

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export

Probab=96.15  E-value=0.0049  Score=36.02  Aligned_cols=18  Identities=33%  Similarity=0.567  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKstLl~~   47 (171)
T cd03228          30 KVAIVGPSGSGKSTLLKL   47 (171)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs

Probab=96.14  E-value=0.0047  Score=36.01  Aligned_cols=17  Identities=24%  Similarity=0.413  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||++..+
T Consensus         2 ~li~G~~G~GKT~l~~~   18 (187)
T cd01124           2 TLLSGGPGTGKTTFALQ   18 (187)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            57889999999999986

A related protein is found in archaea.

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)

Probab=96.14  E-value=0.0052  Score=36.02  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|.+|+|||++...
T Consensus         4 ~i~l~G~~gsGKst~a~~   21 (175)
T cd00227           4 IIILNGGSSAGKSSIARA   21 (175)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985

Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed

Probab=96.14  E-value=0.0054  Score=37.50  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (240)
T PRK09493         29 VVVIIGPSGSGKSTLLRC   46 (240)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>KOG0060|consensus

Probab=96.13  E-value=0.0044  Score=43.40  Aligned_cols=19  Identities=26%  Similarity=0.482  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.||+|+|||||++-
T Consensus       462 ~~LLItG~sG~GKtSLlRv  480 (659)
T KOG0060|consen  462 QNLLITGPSGCGKTSLLRV  480 (659)
T ss_pred             CeEEEECCCCCchhHHHHH
Confidence            3578999999999999963

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional

Probab=96.13  E-value=0.0045  Score=40.82  Aligned_cols=17  Identities=24%  Similarity=0.515  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        48 ~~llGpsGsGKSTLLr~   64 (377)
T PRK11607         48 FALLGASGCGKSTLLRM   64 (377)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            57999999999999974

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A

Probab=96.13  E-value=0.0033  Score=36.66  Aligned_cols=17  Identities=29%  Similarity=0.503  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .++.|++|+|||+++..
T Consensus        22 ~vi~G~Ng~GKStil~a   38 (202)
T PF13476_consen   22 NVIYGPNGSGKSTILEA   38 (202)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            46779999999999975

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit

Probab=96.13  E-value=0.0053  Score=37.33  Aligned_cols=19  Identities=32%  Similarity=0.368  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+.-
T Consensus         7 e~~~l~G~nGsGKSTLl~~   25 (223)
T TIGR03771         7 ELLGLLGPNGAGKTTLLRA   25 (223)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3678999999999999974

This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch

Probab=96.13  E-value=0.005  Score=36.91  Aligned_cols=19  Identities=16%  Similarity=0.256  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+++..
T Consensus        30 ~~~~l~G~Ng~GKStll~~   48 (202)
T cd03243          30 RLLLITGPNMGGKSTYLRS   48 (202)
T ss_pred             eEEEEECCCCCccHHHHHH
Confidence            3689999999999999974

Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria

Probab=96.13  E-value=0.0054  Score=37.31  Aligned_cols=18  Identities=28%  Similarity=0.556  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (236)
T cd03253          29 KVAIVGPSGSGKSTILRL   46 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14237 phosphate transporter ATP-binding protein; Provisional

Probab=96.13  E-value=0.0048  Score=38.50  Aligned_cols=18  Identities=17%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        48 ~~~I~G~nGsGKSTLl~~   65 (267)
T PRK14237         48 ITALIGPSGSGKSTYLRS   65 (267)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional

Probab=96.12  E-value=0.0055  Score=38.07  Aligned_cols=18  Identities=28%  Similarity=0.527  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (258)
T PRK13548         30 VVAILGPNGAGKSTLLRA   47 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>PTZ00258 GTP-binding protein; Provisional

Probab=96.12  E-value=0.015  Score=38.87  Aligned_cols=26  Identities=31%  Similarity=0.437  Sum_probs=21.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNK   36 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~   36 (65)
                      ...+++.++|.++||||+|+.+ +++.
T Consensus        19 ~~~~kvgIVG~PNvGKSTLfna-Lt~~   44 (390)
T PTZ00258         19 GNNLKMGIVGLPNVGKSTTFNA-LCKQ   44 (390)
T ss_pred             CCCcEEEEECCCCCChHHHHHH-HhcC
Confidence            4457999999999999999985 3443

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.12  E-value=0.0049  Score=38.00  Aligned_cols=18  Identities=17%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (252)
T PRK14256         32 VTAIIGPSGCGKSTVLRS   49 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>PRK00131 aroK shikimate kinase; Reviewed

Probab=96.11  E-value=0.0059  Score=35.06  Aligned_cols=19  Identities=21%  Similarity=0.253  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||++...
T Consensus         5 ~~i~l~G~~GsGKstla~~   23 (175)
T PRK00131          5 PNIVLIGFMGAGKSTIGRL   23 (175)
T ss_pred             CeEEEEcCCCCCHHHHHHH
Confidence            4789999999999999874

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component

Probab=96.11  E-value=0.0058  Score=36.58  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (200)
T cd03217          28 VHALMGPNGSGKSTLAKT   45 (200)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.

>TIGR01351 adk adenylate kinases

Probab=96.11  E-value=0.0049  Score=37.18  Aligned_cols=18  Identities=22%  Similarity=0.305  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||++..+
T Consensus         1 rI~i~G~pGsGKsT~a~~   18 (210)
T TIGR01351         1 RLVLLGPPGSGKGTQAKR   18 (210)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999985

Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.11  E-value=0.0055  Score=38.66  Aligned_cols=18  Identities=39%  Similarity=0.554  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (286)
T PRK13646         35 YYAIVGQTGSGKSTLIQN   52 (286)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional

Probab=96.10  E-value=0.0048  Score=39.81  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~ivG~sGsGKSTLl~~   52 (330)
T PRK15093         35 IRGLVGESGSGKSLIAKA   52 (330)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974

>PRK15064 ABC transporter ATP-binding protein; Provisional

Probab=96.10  E-value=0.0051  Score=41.73  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~liG~NGsGKSTLl~~   46 (530)
T PRK15064         29 RYGLIGANGCGKSTFMKI   46 (530)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]

Probab=96.10  E-value=0.0046  Score=40.46  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++||||+|||+++.-
T Consensus        30 ~vaLlGpSGaGKsTlLRi   47 (345)
T COG1118          30 LVALLGPSGAGKSTLLRI   47 (345)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999974

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional

Probab=96.10  E-value=0.0057  Score=38.10  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (265)
T PRK10253         35 FTAIIGPNGCGKSTLLRT   52 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C

Probab=96.10  E-value=0.0051  Score=37.06  Aligned_cols=18  Identities=44%  Similarity=0.621  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (221)
T cd03244          32 KVGIVGRTGSGKSSLLLA   49 (221)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein

Probab=96.10  E-value=0.0058  Score=36.77  Aligned_cols=18  Identities=22%  Similarity=0.475  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~i~G~nGsGKSTLl~~   43 (213)
T TIGR01277        26 IVAIMGPSGAGKSTLLNL   43 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit

Probab=96.10  E-value=0.0056  Score=38.93  Aligned_cols=18  Identities=28%  Similarity=0.279  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        21 ~~~l~G~NGaGKSTLl~~   38 (302)
T TIGR01188        21 VFGFLGPNGAGKTTTIRM   38 (302)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.09  E-value=0.0058  Score=37.64  Aligned_cols=18  Identities=17%  Similarity=0.431  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~I~G~nGsGKSTLl~~   50 (251)
T PRK14244         33 VTAFIGPSGCGKSTFLRC   50 (251)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>cd03290 ABCC_SUR1_N The SUR domain 1

Probab=96.09  E-value=0.0053  Score=37.04  Aligned_cols=18  Identities=33%  Similarity=0.599  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (218)
T cd03290          29 LTMIVGQVGCGKSSLLLA   46 (218)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>PLN02165 adenylate isopentenyltransferase

Probab=96.09  E-value=0.0078  Score=39.46  Aligned_cols=18  Identities=39%  Similarity=0.604  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+|...
T Consensus        45 iivIiGPTGSGKStLA~~   62 (334)
T PLN02165         45 VVVIMGATGSGKSRLSVD   62 (334)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            588999999999999985

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed

Probab=96.08  E-value=0.0053  Score=41.98  Aligned_cols=19  Identities=37%  Similarity=0.578  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -++.++|++|+|||+|+.-
T Consensus       377 ~~vaIvG~SGsGKSTL~~l  395 (588)
T PRK11174        377 QRIALVGPSGAGKTSLLNA  395 (588)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4578999999999999973

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.08  E-value=0.0058  Score=38.15  Aligned_cols=18  Identities=22%  Similarity=0.328  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~I~G~nGsGKSTLl~~   54 (269)
T PRK13648         37 WTSIVGHNGSGKSTIAKL   54 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional

Probab=96.08  E-value=0.0058  Score=37.92  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (262)
T PRK09984         32 MVALLGPSGSGKSTLLRH   49 (262)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants

Probab=96.08  E-value=0.006  Score=34.51  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||++...
T Consensus         2 i~l~G~~GsGKstla~~   18 (154)
T cd00464           2 IVLIGMMGAGKTTVGRL   18 (154)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            78999999999999975

Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Length	Definition	E-value
Query	65
1doa_A	191	Structure Of The Rho Family Gtp-Binding Protein Cdc		5e-04
2dfk_B	194	Crystal Structure Of The Cdc42-Collybistin Ii Compl		6e-04
2wm9_B	190	Structure Of The Complex Between Dock9 And Cdc42. L		6e-04

>pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191

Iteration: 1
 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 8/51 (15%)
Query: 9  HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59
          H + +KCVVVGD AVGKT L+ +   NK        + +VPTV+  D Y +
Sbjct: 3  HMQTIKCVVVGDGAVGKTCLLISYTTNK------FPSEYVPTVF--DNYAV 45

>pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194

Iteration: 1
 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 8/51 (15%)
Query: 9  HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59
          H + +KCVVVGD AVGKT L+ +   NK        + +VPTV+  D Y +
Sbjct: 3  HMQTIKCVVVGDGAVGKTCLLISYTTNK------FPSEYVPTVF--DNYAV 45

>pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190

Iteration: 1
 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 8/51 (15%)
Query: 9  HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59
          H + +KCVVVGD AVGKT L+ +   NK        + +VPTV+  D Y +
Sbjct: 2  HMQTIKCVVVGDGAVGKTCLLISYTTNK------FPSEYVPTVF--DNYAV 44

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	65
2j1l_A	214	RHO-related GTP-binding protein RHOD; GTPase, memb	9e-12
2atx_A	194	Small GTP binding protein TC10; GTPase, P-loop, al	9e-12
3th5_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	1e-11
3reg_A	194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	2e-10
3q3j_B	214	RHO-related GTP-binding protein RHO6; RAS-binding	3e-10
2q3h_A	201	RAS homolog gene family, member U; GTPase, structu	8e-10
3bwd_D	182	RAC-like GTP-binding protein ARAC6; G domain, cyto	9e-10
2gco_A	201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	3e-09
1gwn_A	205	RHO-related GTP-binding protein RHOE; GTPase, inac	3e-09
1m7b_A	184	RND3/RHOE small GTP-binding protein; small GTPase,	5e-09
2fv8_A	207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	1e-08
2j0v_A	212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	6e-08
1mh1_A	186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	8e-08

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214

 Score = 55.9 bits (135), Expect = 9e-12
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 1  MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
          M  +   P    VK V+VGD   GKT L+   A            ++ PTV+  ++Y + 
Sbjct: 23 MAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGA------FPESYTPTVF--ERYMVN 74

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194

 Score = 56.0 bits (135), Expect = 9e-12
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 6  EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
            P   ++KCVVVGD AVGKT L+ + A +           +VPTV+  D Y +  
Sbjct: 12 HGPGALMLKCVVVGDGAVGKTCLLMSYANDA------FPEEYVPTVF--DHYAVSV 59

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204

 Score = 55.5 bits (134), Expect = 1e-11
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 1  MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
             +N     + +KCVVVGD AVGKT L+ +   N           ++PTV+  D Y   
Sbjct: 19 SHMENLYFQGQAIKCVVVGDGAVGKTCLLISYTTNA------FPGEYIPTVF--DNYSAN 70

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194

 Score = 52.0 bits (125), Expect = 2e-10
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 3  SDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI 59
          +   +  ++ +K VVVGD AVGKT L+ A +  +      + T +VPTV+  + +  
Sbjct: 14 AGKIENGKKALKIVVVGDGAVGKTCLLLAFSKGE------IPTAYVPTVF--ENFSH 62

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214

 Score = 51.8 bits (124), Expect = 3e-10
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 8/55 (14%)

Query: 7  QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
          QP     K V+VGD   GKT ++   A +          T+VPTV+  + Y    
Sbjct: 22 QPVVARCKLVLVGDVQCGKTAMLQVLAKDC------YPETYVPTVF--ENYTACL 68

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201

 Score = 50.5 bits (121), Expect = 8e-10
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 8/58 (13%)

Query: 3  SDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
                    VKCV+VGD AVGKT L+ +   N         T ++PT +  D +   
Sbjct: 11 GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNG------YPTEYIPTAF--DNFSAV 60

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182

 Score = 50.4 bits (121), Expect = 9e-10
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
            +KCV VGD AVGKT L+ +   N         T +VPTV+  D +    
Sbjct: 7  RFIKCVTVGDGAVGKTCLLISYTSNT------FPTDYVPTVF--DNFSANV 49

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201

 Score = 49.4 bits (118), Expect = 3e-09
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
           K V+VGD A GKT L+   + +      Q    +VPTV+  + Y    
Sbjct: 26 KKLVIVGDGACGKTCLLIVFSKD------QFPEVYVPTVF--ENYIADI 66

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205

 Score = 49.4 bits (118), Expect = 3e-09
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query: 7  QPHQEL-VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
           P+Q +  K VVVGD+  GKT L+   A +           +VPTV+  + Y    
Sbjct: 22 DPNQNVKCKIVVVGDSQCGKTALLHVFAKD------CFPENYVPTVF--ENYTASF 69

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184

 Score = 48.5 bits (116), Expect = 5e-09
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 8/49 (16%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
           K VVVGD+  GKT L+   A +           +VPTV+  + Y    
Sbjct: 8  CKIVVVGDSQCGKTALLHVFAKD------CFPENYVPTVF--ENYTASF 48

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207

 Score = 47.4 bits (113), Expect = 1e-08
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
           K VVVGD A GKT L+   + +      +    +VPTV+  + Y   
Sbjct: 26 KKLVVVGDGACGKTCLLIVFSKD------EFPEVYVPTVF--ENYVAD 65

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212

 Score = 45.8 bits (109), Expect = 6e-08
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 8/46 (17%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR 58
          +KCV VGD AVGKT ++     NK        T ++PTV+  D + 
Sbjct: 10 IKCVTVGDGAVGKTCMLICYTSNK------FPTDYIPTVF--DNFS 47

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186

 Score = 45.1 bits (107), Expect = 8e-08
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query: 9  HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
            + +KCVVVGD AVGKT L+ +   N           ++PTV+  D Y   
Sbjct: 2  SPQAIKCVVVGDGAVGKTCLLISYTTNA------FPGEYIPTVF--DNYSAN 45

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	65
4dkx_A	216	RAS-related protein RAB-6A; GTP binding fold, memb	99.39
3bc1_A	195	RAS-related protein RAB-27A; RAB27, GTPase, RAB, s	99.08
3q3j_B	214	RHO-related GTP-binding protein RHO6; RAS-binding	99.0
2f7s_A	217	C25KG, RAS-related protein RAB-27B; G-protein, str	98.99
3t1o_A	198	Gliding protein MGLA; G domain containing protein,	98.99
2oil_A	193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	98.99
3c5c_A	187	RAS-like protein 12; GDP, GTPase, structural genom	98.98
2ew1_A	201	RAS-related protein RAB-30; G-protein, GTP analogu	98.98
2iwr_A	178	Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi	98.98
1oix_A	191	RAS-related protein RAB-11A; small G protein, intr	98.97
2atx_A	194	Small GTP binding protein TC10; GTPase, P-loop, al	98.96
2j1l_A	214	RHO-related GTP-binding protein RHOD; GTPase, memb	98.96
2y8e_A	179	RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti	98.95
2fu5_C	183	RAS-related protein RAB-8A; MSS4:RAB8 protein comp	98.95
1gwn_A	205	RHO-related GTP-binding protein RHOE; GTPase, inac	98.95
1m7b_A	184	RND3/RHOE small GTP-binding protein; small GTPase,	98.93
3reg_A	194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	98.93
2hup_A	201	RAS-related protein RAB-43; G-protein, GDP, struct	98.93
2bme_A	186	RAB4A, RAS-related protein RAB4A; GTP-binding prot	98.92
3gj0_A	221	GTP-binding nuclear protein RAN; G protein, GDP, a	98.91
2fn4_A	181	P23, RAS-related protein R-RAS; GDP/GTP binding, G	98.91
3ihw_A	184	Centg3; RAS, centaurin, GTPase, structural genomic	98.91
3kkq_A	183	RAS-related protein M-RAS; GTP-binding, GTPase, si	98.9
2hxs_A	178	RAB-26, RAS-related protein RAB-28; GTPase, signal	98.9
2f9l_A	199	RAB11B, member RAS oncogene family; RAB11B GTPase,	98.89
2il1_A	192	RAB12; G-protein, GDP, GTPase, predicted, structur	98.89
2efe_B	181	Small GTP-binding protein-like; GEF, GTPase, VPS9,	98.89
3tw8_B	181	RAS-related protein RAB-35; longin domain, RAB GTP	98.89
1wms_A	177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	98.89
1z0f_A	179	RAB14, member RAS oncogene family; RAB GTPase, ves	98.89
2j0v_A	212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	98.89
2atv_A	196	RERG, RAS-like estrogen-regulated growth inhibitor	98.89
4bas_A	199	ADP-ribosylation factor, putative (small GTPase, p	98.88
3cpj_B	223	GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl	98.88
1ky3_A	182	GTP-binding protein YPT7P; vesicular traffic, GTP	98.88
1c1y_A	167	RAS-related protein RAP-1A; GTP-binding proteins,	98.88
2o52_A	200	RAS-related protein RAB-4B; G-protein, GDP, struct	98.88
2q3h_A	201	RAS homolog gene family, member U; GTPase, structu	98.87
2a5j_A	191	RAS-related protein RAB-2B; GTPase, signal transdu	98.87
1zbd_A	203	Rabphilin-3A; G protein, effector, RABCDR, synapti	98.87
1z2a_A	168	RAS-related protein RAB-23; RAB GTPase, vesicular	98.86
2zej_A	184	Dardarin, leucine-rich repeat kinase 2; parkinson'	98.86
1z08_A	170	RAS-related protein RAB-21; RAB GTPase, vesicular	98.86
1vg8_A	207	RAS-related protein RAB-7; GTP-binding protein, pr	98.86
2bcg_Y	206	Protein YP2, GTP-binding protein YPT1; RABGTPase,	98.86
4gzl_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	98.85
1mh1_A	186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	98.84
2gf9_A	189	RAS-related protein RAB-3D; G-protein, structural	98.84
1kao_A	167	RAP2A; GTP-binding protein, small G protein, GDP,	98.84
1z0j_A	170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	98.84
3cbq_A	195	GTP-binding protein REM 2; FLJ38964A, structural g	98.84
2bov_A	206	RAla, RAS-related protein RAL-A; C3BOT, exoenzyme,	98.83
3t5g_A	181	GTP-binding protein RHEB; immunoglobulin-like beta	98.83
2fg5_A	192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	98.83
1x3s_A	195	RAS-related protein RAB-18; GTPase, GNP, structura	98.82
3tkl_A	196	RAS-related protein RAB-1A; vesicle trafficking, p	98.82
1r2q_A	170	RAS-related protein RAB-5A; GTPase, GNP, atomic re	98.82
1zd9_A	188	ADP-ribosylation factor-like 10B; transport protei	98.82
2g3y_A	211	GTP-binding protein GEM; small GTPase, GDP, inacti	98.82
1z06_A	189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	98.81
3clv_A	208	RAB5 protein, putative; malaria, GTPase, structura	98.81
3dz8_A	191	RAS-related protein RAB-3B; GDP, GTPase, structura	98.81
1ek0_A	170	Protein (GTP-binding protein YPT51); vesicular tra	98.81
2p5s_A	199	RAS and EF-hand domain containing; G-protein, RAB,	98.81
2a9k_A	187	RAS-related protein RAL-A; bacterial ADP-ribosyltr	98.79
2erx_A	172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	98.79
3oes_A	201	GTPase rhebl1; small GTPase, structural genomics,	98.79
1u8z_A	168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	98.78
2gco_A	201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	98.78
4dsu_A	189	GTPase KRAS, isoform 2B; small G-protein, signalin	98.78
1g16_A	170	RAS-related protein SEC4; G protein RAB, signaling	98.78
3bwd_D	182	RAC-like GTP-binding protein ARAC6; G domain, cyto	98.77
2yc2_C	208	IFT27, small RAB-related GTPase; transport protein	98.77
3con_A	190	GTPase NRAS; structural genomics consortium, SGC,	98.75
2gf0_A	199	GTP-binding protein DI-RAS1; GDP/GTP binding, GTP	98.74
2fh5_B	214	SR-beta, signal recognition particle receptor beta	98.73
2ce2_X	166	GTPase HRAS; signaling protein, guanine nucleotide	98.72
2fv8_A	207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	98.72
2g6b_A	180	RAS-related protein RAB-26; G-protein, GTP analogu	98.71
2cjw_A	192	GTP-binding protein GEM; nucleotide-binding, small	98.7
3cph_A	213	RAS-related protein SEC4; RAB GTPase, prenylation,	98.7
3r7w_B	331	Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT	98.67
3l0i_B	199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	98.67
3th5_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	98.12
3c5h_A	255	Glucocorticoid receptor DNA-binding factor 1; RAS,	98.65
3q85_A	169	GTP-binding protein REM 2; G-domain, CAV2 beta, si	98.63
2nzj_A	175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	98.62
1fzq_A	181	ADP-ribosylation factor-like protein 3; protein-GD	98.6
1ksh_A	186	ARF-like protein 2; small GTPase, small GTP-bindin	98.6
1nrj_B	218	SR-beta, signal recognition particle receptor beta	98.6
1r8s_A	164	ADP-ribosylation factor 1; protein transport/excha	98.6
2h17_A	181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	98.58
2h57_A	190	ADP-ribosylation factor-like protein 6; GTP, GTPas	98.57
1zj6_A	187	ADP-ribosylation factor-like protein 5; ARL, GTP-b	98.57
4djt_A	218	GTP-binding nuclear protein GSP1; structural genom	98.56
2wjg_A	188	FEOB, ferrous iron transport protein B homolog; me	98.55
2wkq_A	332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	98.55
2wji_A	165	Ferrous iron transport protein B homolog; membrane	98.53
2b6h_A	192	ADP-ribosylation factor 5; membrane trafficking, G	98.51
3r7w_A	307	Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT	98.49
3q72_A	166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	98.48
2ged_A	193	SR-beta, signal recognition particle receptor beta	98.47
3dpu_A	535	RAB family protein; roccor, G-domain, COR, GTP-bin	98.47
1upt_A	171	ARL1, ADP-ribosylation factor-like protein 1; hydr	98.46
1f6b_A	198	SAR1; gtpases, N-terminal helix, Mg-containing com	98.46
2x77_A	189	ADP-ribosylation factor; GTP-binding protein, smal	98.45
2lkc_A	178	Translation initiation factor IF-2; NMR {Geobacill	98.45
1moz_A	183	ARL1, ADP-ribosylation factor-like protein 1; GTP-	98.42
2cxx_A	190	Probable GTP-binding protein ENGB; structural geno	98.38
1m2o_B	190	GTP-binding protein SAR1, GTP binding protein; zin	98.36
1svi_A	195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	98.35
3t5d_A	274	Septin-7; GTP-binding protein, cytoskeleton, signa	98.35
2hf9_A	226	Probable hydrogenase nickel incorporation protein	98.33
3o47_A	329	ADP-ribosylation factor GTPase-activating protein	98.33
3llu_A	196	RAS-related GTP-binding protein C; structural geno	98.32
2qu8_A	228	Putative nucleolar GTP-binding protein 1; GTPase,	98.28
3pqc_A	195	Probable GTP-binding protein ENGB; rossmann fold,	98.26
2dyk_A	161	GTP-binding protein; GTPase, ribosome-binding prot	98.23
3a1s_A	258	Iron(II) transport protein B; FEOB, iron transport	98.22
3lxx_A	239	GTPase IMAP family member 4; structural genomics c	98.19
3b1v_A	272	Ferrous iron uptake transporter protein B; G prote	98.19
1pui_A	210	ENGB, probable GTP-binding protein ENGB; structura	98.18
2gj8_A	172	MNME, tRNA modification GTPase TRME; G-domain dime	98.18
2qag_A	361	Septin-2, protein NEDD5; cell cycle, cell division	98.11
3lxw_A	247	GTPase IMAP family member 1; immunity, structural	98.1
2xtp_A	260	GTPase IMAP family member 2; immune system, G prot	98.07
3k53_A	271	Ferrous iron transport protein B; GTPase fold, hel	98.04
3lvq_E	497	ARF-GAP with SH3 domain, ANK repeat and PH domain	98.04
3i8s_A	274	Ferrous iron transport protein B; GTPase, GPCR, ir	97.95
1h65_A	270	Chloroplast outer envelope protein OEP34; GTPase,	97.92
3iby_A	256	Ferrous iron transport protein B; G protein, G dom	97.88
3def_A	262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	97.87
4dhe_A	223	Probable GTP-binding protein ENGB; melioidosis, RA	97.79
3qq5_A	423	Small GTP-binding protein; hydrogenase, H-cluster,	97.66
2aka_B	299	Dynamin-1; fusion protein, GTPase domain, myosin,	97.63
2qnr_A	301	Septin-2, protein NEDD5; structural genomics conso	97.61
2hjg_A	436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	97.61
1ega_A	301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	97.61
2e87_A	357	Hypothetical protein PH1320; GTP-binding, GTPase,	97.58
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	97.57
1wf3_A	301	GTP-binding protein; GTPase, riken structural geno	97.57
1wxq_A	397	GTP-binding protein; structural genomics, riken st	97.55
2qag_C	418	Septin-7; cell cycle, cell division, GTP-binding,	97.54
3iev_A	308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	97.52
1lnz_A	342	SPO0B-associated GTP-binding protein; GTPase, OBG,	97.51
2qtf_A	364	Protein HFLX, GTP-binding protein; beta-alpha-barr	97.5
3gee_A	476	MNME, tRNA modification GTPase MNME; G protein, cy	97.49
3sjy_A	403	Translation initiation factor 2 subunit gamma; zin	97.47
1kgd_A	180	CASK, peripheral plasma membrane CASK; maguk, guan	97.46
1kk1_A	410	EIF2gamma; initiation of translation; HET: GNP; 1.	97.45
1ex7_A	186	Guanylate kinase; substrate-induced FIT, domain mo	97.42
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	97.4
1lvg_A	198	Guanylate kinase, GMP kinase; transferase; HET: AD	97.39
2wsm_A	221	Hydrogenase expression/formation protein (HYPB); m	97.38
1jal_A	363	YCHF protein; nucleotide-binding fold, structural	97.37
1ye8_A	178	Protein THEP1, hypothetical UPF0334 kinase-like pr	97.37
1s0u_A	408	EIF-2-gamma, translation initiation factor 2 gamma	97.36
1zp6_A	191	Hypothetical protein ATU3015; alpha-beta protein.,	97.36
3sop_A	270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	97.36
3t34_A	360	Dynamin-related protein 1A, linker, dynamin-relat	97.32
2dby_A	368	GTP-binding protein; GDP, structural genomics, NPP	97.3
4dcu_A	456	GTP-binding protein ENGA; GTPase, GDP, protein bin	97.3
4gp7_A	171	Metallophosphoesterase; polynucleotide kinase phos	97.26
3a00_A	186	Guanylate kinase, GMP kinase; domain movement, dim	97.24
1s96_A	219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	97.23
3ney_A	197	55 kDa erythrocyte membrane protein; structural ge	97.22
3tr0_A	205	Guanylate kinase, GMP kinase; purines, pyrimidines	97.22
3tau_A	208	Guanylate kinase, GMP kinase; structural genomics,	97.21
1znw_A	207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	97.2
4dcu_A	456	GTP-binding protein ENGA; GTPase, GDP, protein bin	97.19
1z6g_A	218	Guanylate kinase; structural genomics, SGC, struct	97.16
2hjg_A	436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	97.15
2x2e_A	353	Dynamin-1; nitration, hydrolase, membrane fission,	97.15
1udx_A	416	The GTP-binding protein OBG; TGS domain, riken str	97.08
1dar_A	691	EF-G, elongation factor G; ribosomal translocase,	97.04
2qor_A	204	Guanylate kinase; phosphotransferase, purine metab	97.04
2ohf_A	396	Protein OLA1, GTP-binding protein 9; ATPase, GTPas	97.02
3izy_P	537	Translation initiation factor IF-2, mitochondrial;	97.01
3tif_A	235	Uncharacterized ABC transporter ATP-binding prote;	97.0
1via_A	175	Shikimate kinase; structural genomics, transferase	96.99
1htw_A	158	HI0065; nucleotide-binding fold, structural genomi	96.98
1ni3_A	392	YCHF GTPase, YCHF GTP-binding protein; structural	96.98
1jwy_B	315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	96.97
1knq_A	175	Gluconate kinase; ALFA/beta structure, transferase	96.97
1jbk_A	195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	96.95
2bdt_A	189	BH3686; alpha-beta protein, structural genomics, P	96.94
3c8u_A	208	Fructokinase; YP_612366.1, putative fructose trans	96.93
3kb2_A	173	SPBC2 prophage-derived uncharacterized protein YOR	96.93
1xzp_A	482	Probable tRNA modification GTPase TRME; GTP-bindin	96.93
3ec2_A	180	DNA replication protein DNAC; helicase loader, rep	96.92
2ehv_A	251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	96.89
3geh_A	462	MNME, tRNA modification GTPase MNME; G protein, U3	96.89
1kag_A	173	SKI, shikimate kinase I; transferase, structural g	96.89
3vaa_A	199	Shikimate kinase, SK; structural genomics, center	96.89
1b0u_A	262	Histidine permease; ABC transporter, transport pro	96.87
1zun_B	434	Sulfate adenylate transferase, subunit 1/adenylyls	96.86
2j41_A	207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	96.86
2cbz_A	237	Multidrug resistance-associated protein 1; ABC pro	96.86
1mv5_A	243	LMRA, multidrug resistance ABC transporter ATP-bin	96.86
2pcj_A	224	ABC transporter, lipoprotein-releasing system ATP-	96.86
1qhx_A	178	CPT, protein (chloramphenicol phosphotransferase);	96.85
1g7s_A	594	Translation initiation factor IF2/EIF5B; translati	96.84
2ff7_A	247	Alpha-hemolysin translocation ATP-binding protein	96.84
2onk_A	240	Molybdate/tungstate ABC transporter, ATP-binding p	96.84
3lw7_A	179	Adenylate kinase related protein (ADKA-like); AMP,	96.82
3lnc_A	231	Guanylate kinase, GMP kinase; ALS collaborative cr	96.82
3gfo_A	275	Cobalt import ATP-binding protein CBIO 1; structur	96.81
3cnl_A	262	YLQF, putative uncharacterized protein; circular p	96.81
2i3b_A	189	HCR-ntpase, human cancer-related ntpase; AAA, ross	96.81
2qag_B	427	Septin-6, protein NEDD5; cell cycle, cell division	96.8
1g6h_A	257	High-affinity branched-chain amino acid transport	96.8
2bbw_A	246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	96.79
3uie_A	200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	96.79
4eun_A	200	Thermoresistant glucokinase; putative sugar kinase	96.79
3e70_C	328	DPA, signal recognition particle receptor; FTSY, S	96.78
2pze_A	229	Cystic fibrosis transmembrane conductance regulat;	96.78
2olj_A	263	Amino acid ABC transporter; ABC domain, ATPase, hy	96.78
1ji0_A	240	ABC transporter; ATP binding protein, structural g	96.77
1lw7_A	365	Transcriptional regulator NADR; NMN, NMN adenylyl	96.76
2ihy_A	279	ABC transporter, ATP-binding protein; ATPase, ABC	96.76
4g1u_C	266	Hemin import ATP-binding protein HMUV; membrane tr	96.76
2eyu_A	261	Twitching motility protein PILT; pilus retraction	96.76
1sgw_A	214	Putative ABC transporter; structural genomics, P p	96.75
3trf_A	185	Shikimate kinase, SK; amino acid biosynthesis, tra	96.75
2ghi_A	260	Transport protein; multidrug resistance protein, M	96.75
2ixe_A	271	Antigen peptide transporter 1; ABC ATPase, hydrola	96.74
1ixz_A	254	ATP-dependent metalloprotease FTSH; AAA domain fol	96.74
4a74_A	231	DNA repair and recombination protein RADA; hydrola	96.73
3b85_A	208	Phosphate starvation-inducible protein; PHOH2, ATP	96.73
2d2e_A	250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	96.73
2zu0_C	267	Probable ATP-dependent transporter SUFC; iron-sulf	96.73
2p65_A	187	Hypothetical protein PF08_0063; CLPB, malaria, str	96.72
2qi9_C	249	Vitamin B12 import ATP-binding protein BTUD; inner	96.72
1vpl_A	256	ABC transporter, ATP-binding protein; TM0544, stru	96.69
4a9a_A	376	Ribosome-interacting GTPase 1; DRG-DFRP complex, r	96.69
3bos_A	242	Putative DNA replication factor; P-loop containing	96.68
2yz2_A	266	Putative ABC transporter ATP-binding protein TM_0;	96.67
1cke_A	227	CK, MSSA, protein (cytidine monophosphate kinase);	96.67
2pjz_A	263	Hypothetical protein ST1066; ATP binding protein,	96.66
1rj9_A	304	FTSY, signal recognition protein; SRP-GTPase domai	96.66
1z47_A	355	CYSA, putative ABC-transporter ATP-binding protein	96.66
2qpt_A	550	EH domain-containing protein-2; protein-nucleotide	96.65
3asz_A	211	Uridine kinase; cytidine phosphorylation, transfer	96.65
1ly1_A	181	Polynucleotide kinase; PNK, phosphatase, transfera	96.65
2kjq_A	149	DNAA-related protein; solution structure, NESG, st	96.65
3t61_A	202	Gluconokinase; PSI-biology, structural genomics, p	96.64
2it1_A	362	362AA long hypothetical maltose/maltodextrin trans	96.64
2yyz_A	359	Sugar ABC transporter, ATP-binding protein; sugar	96.64
3fvq_A	359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	96.64
2nq2_C	253	Hypothetical ABC transporter ATP-binding protein H	96.64
1v43_A	372	Sugar-binding transport ATP-binding protein; ATPas	96.62
1g29_1	372	MALK, maltose transport protein MALK; ATPase, acti	96.62
3fb4_A	216	Adenylate kinase; psychrophIle, phosphotransferase	96.62
3rlf_A	381	Maltose/maltodextrin import ATP-binding protein M;	96.62
2jaq_A	205	Deoxyguanosine kinase; transferase, deoxyribonucle	96.61
3dl0_A	216	Adenylate kinase; phosphotransferase, zinc coordin	96.61
2w58_A	202	DNAI, primosome component (helicase loader); ATP-b	96.6
1kht_A	192	Adenylate kinase; phosphotransferase, signaling pr	96.59
1nks_A	194	Adenylate kinase; thermophilic, transferase; HET:	96.59
2chg_A	226	Replication factor C small subunit; DNA-binding pr	96.58
3d31_A	348	Sulfate/molybdate ABC transporter, ATP-binding pro	96.58
1njg_A	250	DNA polymerase III subunit gamma; rossman-like fol	96.58
3nh6_A	306	ATP-binding cassette SUB-family B member 6, mitoc;	96.58
3j2k_7	439	ERF3, eukaryotic polypeptide chain release factor	96.57
1iy2_A	278	ATP-dependent metalloprotease FTSH; AAA domain fol	96.57
2v9p_A	305	Replication protein E1; AAA+ molecular motor, DNA	96.56
3b9q_A	302	Chloroplast SRP receptor homolog, alpha subunit CP	96.56
2cdn_A	201	Adenylate kinase; phosphoryl transfer, associative	96.56
2vp4_A	230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	96.56
1gvn_B	287	Zeta; postsegregational killing system, plasmid; 1	96.55
3kta_A	182	Chromosome segregation protein SMC; structural mai	96.54
2yv5_A	302	YJEQ protein; hydrolase, GTPase, permutation, stru	96.53
1lv7_A	257	FTSH; alpha/beta domain, four helix bundle, hydrol	96.52
1u0l_A	301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	96.51
2w0m_A	235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	96.5
1in4_A	334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	96.5
2x8a_A	274	Nuclear valosin-containing protein-like; nuclear p	96.5
3iij_A	180	Coilin-interacting nuclear ATPase protein; alpha a	96.5
1wb1_A	482	Translation elongation factor SELB; selenocysteine	96.49
2yvu_A	186	Probable adenylyl-sulfate kinase; transferase, str	96.49
3p26_A	483	Elongation factor 1 alpha-like protein; GTP/GDP bi	96.47
1np6_A	174	Molybdopterin-guanine dinucleotide biosynthesis pr	96.47
2www_A	349	Methylmalonic aciduria type A protein, mitochondri	96.45
2bbs_A	290	Cystic fibrosis transmembrane conductance regulato	96.45
3izq_1	611	HBS1P, elongation factor 1 alpha-like protein; NO-	96.45
3gd7_A	390	Fusion complex of cystic fibrosis transmembrane co	96.43
2if2_A	204	Dephospho-COA kinase; alpha-beta protein, structur	96.43
2rcn_A	358	Probable GTPase ENGC; YJEQ, circularly permuted, G	96.42
3cm0_A	186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	96.41
1jjv_A	206	Dephospho-COA kinase; P-loop nucleotide-binding fo	96.41
2ze6_A	253	Isopentenyl transferase; crown GALL tumor, cytokin	96.41
3aez_A	312	Pantothenate kinase; transferase, homodimer, COA b	96.4
1oxx_K	353	GLCV, glucose, ABC transporter, ATP binding protei	96.4
3h4m_A	285	Proteasome-activating nucleotidase; ATPase, PAN, A	96.38
3n70_A	145	Transport activator; sigma-54, ntpase, PSI, MCSG,	96.38
3tui_C	366	Methionine import ATP-binding protein METN; ABC-tr	96.37
1odf_A	290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	96.37
2qz4_A	262	Paraplegin; AAA+, SPG7, protease, ADP, structural	96.37
2rhm_A	193	Putative kinase; P-loop containing nucleoside trip	96.36
3p32_A	355	Probable GTPase RV1496/MT1543; structural genomics	96.36
1puj_A	282	YLQF, conserved hypothetical protein YLQF; structu	96.36
3tr5_A	528	RF-3, peptide chain release factor 3; protein synt	96.34
2c78_A	405	Elongation factor TU-A; hydrolase, GTPase, transla	96.33
1jny_A	435	EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-	96.33
2og2_A	359	Putative signal recognition particle receptor; nuc	96.31
2f1r_A	171	Molybdopterin-guanine dinucleotide biosynthesis pr	96.31
2j69_A	695	Bacterial dynamin-like protein; FZO, FZL, GTPase,	96.31
3tlx_A	243	Adenylate kinase 2; structural genomics, structura	96.3
1l8q_A	324	Chromosomal replication initiator protein DNAA; AA	96.3
4e22_A	252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	96.29
1y63_A	184	LMAJ004144AAA protein; structural genomics, protei	96.29
3jvv_A	356	Twitching mobility protein; hexameric P-loop ATPas	96.29
2qen_A	350	Walker-type ATPase; unknown function; HET: ADP; 2.	96.29
1ukz_A	203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	96.28
1n0w_A	243	DNA repair protein RAD51 homolog 1; DNA repair, ho	96.28
3tqc_A	321	Pantothenate kinase; biosynthesis of cofactors, pr	96.28
1ofh_A	310	ATP-dependent HSL protease ATP-binding subunit HSL	96.28
2qt1_A	207	Nicotinamide riboside kinase 1; non-protein kinase	96.27
3b9p_A	297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	96.27
3mca_A	592	HBS1, elongation factor 1 alpha-like protein; prot	96.25
3a8t_A	339	Adenylate isopentenyltransferase; rossmann fold pr	96.25
2plr_A	213	DTMP kinase, probable thymidylate kinase; TMP-bind	96.25
1d2e_A	397	Elongation factor TU (EF-TU); G-protein, beta-barr	96.25
2ewv_A	372	Twitching motility protein PILT; pilus retraction	96.24
1zcb_A	362	G alpha I/13; GTP-binding, lipoprotein, membrane,	96.24
1uf9_A	203	TT1252 protein; P-loop, nucleotide binding domain,	96.24
2qby_A	386	CDC6 homolog 1, cell division control protein 6 ho	96.23
2cvh_A	220	DNA repair and recombination protein RADB; filamen	96.22
1d2n_A	272	N-ethylmaleimide-sensitive fusion protein; hexamer	96.21
2jeo_A	245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	96.18
2dy1_A	665	Elongation factor G; translocation, GTP complex, s	96.17
3exa_A	322	TRNA delta(2)-isopentenylpyrophosphate transferase	96.17
3syl_A	309	Protein CBBX; photosynthesis, rubisco activase, AA	96.16
2gza_A	361	Type IV secretion system protein VIRB11; ATPase, h	96.15
1n0u_A	842	EF-2, elongation factor 2; G-protein, CIS-proline,	96.15
1yrb_A	262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	96.15
2fna_A	357	Conserved hypothetical protein; structural genomic	96.14
2qgz_A	308	Helicase loader, putative primosome component; str	96.14
2p5t_B	253	PEZT; postsegregational killing system, phosphoryl	96.13
1f2t_A	149	RAD50 ABC-ATPase; DNA double-strand break repair,	96.13
1tev_A	196	UMP-CMP kinase; ploop, NMP binding region, LID reg	96.13
1fnn_A	389	CDC6P, cell division control protein 6; ORC1, AAA	96.12
2wwf_A	212	Thymidilate kinase, putative; transferase, malaria	96.11
1aky_A	220	Adenylate kinase; ATP:AMP phosphotransferase, myok	96.11
2yhs_A	503	FTSY, cell division protein FTSY; cell cycle, prot	96.09
3pfi_A	338	Holliday junction ATP-dependent DNA helicase RUVB;	96.09
4fcw_A	311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	96.08
1zd8_A	227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	96.08
2v54_A	204	DTMP kinase, thymidylate kinase; nucleotide biosyn	96.08
3t15_A	293	Ribulose bisphosphate carboxylase/oxygenase activ	96.07
2pt7_A	330	CAG-ALFA; ATPase, protein-protein complex, type IV	96.07
1f60_A	458	Elongation factor EEF1A; protein-protein complex,	96.07
1vma_A	306	Cell division protein FTSY; TM0570, structural gen	96.07
1sxj_E	354	Activator 1 40 kDa subunit; clamp loader, processi	96.06
2pt5_A	168	Shikimate kinase, SK; aromatic amino acid biosynth	96.06
1cr0_A	296	DNA primase/helicase; RECA-type protein fold, tran	96.06
3co5_A	143	Putative two-component system transcriptional RES	96.06
3cf0_A	301	Transitional endoplasmic reticulum ATPase; AAA, P9	96.06
1e4v_A	214	Adenylate kinase; transferase(phosphotransferase);	96.05
2qmh_A	205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	96.05
1bif_A	469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	96.04
2v1u_A	387	Cell division control protein 6 homolog; DNA repli	96.04
1t9h_A	307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	96.04
1zo1_I	501	IF2, translation initiation factor 2; E. coli, rib	96.03
2qm8_A	337	GTPase/ATPase; G protein, G3E, metallochaperone, c	96.03
1tq4_A	413	IIGP1, interferon-inducible GTPase; interferon gam	96.02
2z0h_A	197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	96.02
3sr0_A	206	Adenylate kinase; phosphoryl transfer analogue, AL	96.02
3d3q_A	340	TRNA delta(2)-isopentenylpyrophosphate transferase	96.02
2xtz_A	354	Guanine nucleotide-binding protein alpha-1 subuni;	96.01
2r8r_A	228	Sensor protein; KDPD, PFAM02702, MCSG, structural	96.0
2bjv_A	265	PSP operon transcriptional activator; AAA, transcr	96.0
1zak_A	222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	95.99
3foz_A	316	TRNA delta(2)-isopentenylpyrophosphate transferas;	95.99
1xjc_A	169	MOBB protein homolog; structural genomics, midwest	95.98
2xb4_A	223	Adenylate kinase; ATP-binding, nucleotide-binding,	95.98
2npi_A	460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	95.96
1um8_A	376	ATP-dependent CLP protease ATP-binding subunit CL;	95.95
2obl_A	347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	95.94
4a82_A	578	Cystic fibrosis transmembrane conductance regulat;	95.94
2grj_A	192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	95.94
3b5x_A	582	Lipid A export ATP-binding/permease protein MSBA;	95.93
1e6c_A	173	Shikimate kinase; phosphoryl transfer, ADP, shikim	95.92
3kl4_A	433	SRP54, signal recognition 54 kDa protein; signal r	95.92
2dpy_A	438	FLII, flagellum-specific ATP synthase; beta barrel	95.92
1rz3_A	201	Hypothetical protein rbstp0775; MCSG, structural g	95.91
3uk6_A	368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	95.91
3szr_A	608	Interferon-induced GTP-binding protein MX1; interf	95.91
1qf9_A	194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	95.9
3b60_A	582	Lipid A export ATP-binding/permease protein MSBA;	95.9
1p9r_A	418	General secretion pathway protein E; bacterial typ	95.9
3pxg_A	468	Negative regulator of genetic competence CLPC/MEC;	95.89
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	95.89
3eie_A	322	Vacuolar protein sorting-associated protein 4; AAA	95.89
3crm_A	323	TRNA delta(2)-isopentenylpyrophosphate transferase	95.88
2elf_A	370	Protein translation elongation factor 1A; tRNA, py	95.88
2xex_A	693	Elongation factor G; GTPase, translation, biosynth	95.88
1sq5_A	308	Pantothenate kinase; P-loop, transferase; HET: PAU	95.88
1uj2_A	252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	95.87
2oap_1	511	GSPE-2, type II secretion system protein; hexameri	95.86
1ak2_A	233	Adenylate kinase isoenzyme-2; nucleoside monophosp	95.86
2dr3_A	247	UPF0273 protein PH0284; RECA superfamily ATPase, h	95.86
2px0_A	296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	95.85
2c95_A	196	Adenylate kinase 1; transferase, AP4A, nucleotide	95.85
2qby_B	384	CDC6 homolog 3, cell division control protein 6 ho	95.85
2bwj_A	199	Adenylate kinase 5; phosphoryl transfer reaction,	95.83
3nwj_A	250	ATSK2; P loop, shikimate, nucleoside monophosphate	95.83
3hws_A	363	ATP-dependent CLP protease ATP-binding subunit CL;	95.83
3qf7_A	365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	95.82
1gtv_A	214	TMK, thymidylate kinase; transferase, transferase	95.82
2pez_A	179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	95.81
2yl4_A	595	ATP-binding cassette SUB-family B member 10, mitoc	95.81
1sxj_D	353	Activator 1 41 kDa subunit; clamp loader, processi	95.81
2pbr_A	195	DTMP kinase, thymidylate kinase; transferase, nucl	95.8
1sxj_C	340	Activator 1 40 kDa subunit; clamp loader, processi	95.79
2h5e_A	529	Peptide chain release factor RF-3; beta barrel, tr	95.78
2a5y_B	549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	95.78
1hqc_A	324	RUVB; extended AAA-ATPase domain, complex with nuc	95.77
3euj_A	483	Chromosome partition protein MUKB, linker; MUKB, M	95.76
1xwi_A	322	SKD1 protein; VPS4B, AAA ATPase, protein transport	95.76
3qf4_A	587	ABC transporter, ATP-binding protein; multidrug tr	95.76
3qf4_B	598	Uncharacterized ABC transporter ATP-binding prote	95.74
2r44_A	331	Uncharacterized protein; putative ATPase, structur	95.73
2r62_A	268	Cell division protease FTSH homolog; ATPase domain	95.73
3r20_A	233	Cytidylate kinase; structural genomics, seattle st	95.73
2iyv_A	184	Shikimate kinase, SK; transferase, aromatic amino	95.72
3ohm_A	327	Guanine nucleotide-binding protein G(Q) subunit A;	95.72
3a4m_A	260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	95.71
2z4s_A	440	Chromosomal replication initiator protein DNAA; AA	95.71
3d8b_A	357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	95.68
1nlf_A	279	Regulatory protein REPA; replicative DNA helicase	95.68
1m7g_A	211	Adenylylsulfate kinase; APS kinase, transferase, s	95.67
3m6a_A	543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	95.65
1nn5_A	215	Similar to deoxythymidylate kinase (thymidylate K;	95.64
1ltq_A	301	Polynucleotide kinase; phosphatase, alpha/beta, P-	95.64
1vht_A	218	Dephospho-COA kinase; structural genomics, transfe	95.62
3dm5_A	443	SRP54, signal recognition 54 kDa protein; protein-	95.62
2vli_A	183	Antibiotic resistance protein; transferase, tunica	95.62
3qks_A	203	DNA double-strand break repair RAD50 ATPase; RECA-	95.6
3ux8_A	670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	95.59
3vfd_A	389	Spastin; ATPase, microtubule severing, hydrolase;	95.58
1z6t_A	591	APAF-1, apoptotic protease activating factor 1; ca	95.58
4fid_A	340	G protein alpha subunit; RAS-like domain, all-heli	95.56
1g8p_A	350	Magnesium-chelatase 38 kDa subunit; parallel beta	95.55
2qp9_X	355	Vacuolar protein sorting-associated protein 4; ATP	95.55
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	95.55
3be4_A	217	Adenylate kinase; malaria, cryptosporidium parvum	95.54
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	95.49
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	95.47
2f6r_A	281	COA synthase, bifunctional coenzyme A synthase; 18	95.47
4eaq_A	229	DTMP kinase, thymidylate kinase; structural genomi	95.47
3umf_A	217	Adenylate kinase; rossmann fold, transferase; 2.05	95.46
3pvs_A	447	Replication-associated recombination protein A; ma	95.44
1r5b_A	467	Eukaryotic peptide chain release factor GTP-bindi	95.44
3ux8_A	670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	95.43
3eph_A	409	TRNA isopentenyltransferase; transferase, alternat	95.43
1nij_A	318	Hypothetical protein YJIA; structural genomics, P-	95.43
3qkt_A	339	DNA double-strand break repair RAD50 ATPase; RECA-	95.42
1p5z_B	263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	95.39
1jr3_A	373	DNA polymerase III subunit gamma; processivity, pr	95.39
1svm_A	377	Large T antigen; AAA+ fold, viral protein; HET: AT	95.38
1cip_A	353	Protein (guanine nucleotide-binding protein alpha-	95.37
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	95.33
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	95.31
1iqp_A	327	RFCS; clamp loader, extended AAA-ATPase domain, co	95.3
4b4t_K	428	26S protease regulatory subunit 6B homolog; hydrol	95.28
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	95.27
1e69_A	322	Chromosome segregation SMC protein; structural mai	95.26
2zan_A	444	Vacuolar protein sorting-associating protein 4B; S	95.26
1zuh_A	168	Shikimate kinase; alpha-beta protein, transferase;	95.25
1sxj_A	516	Activator 1 95 kDa subunit; clamp loader, processi	95.24
3zvl_A	416	Bifunctional polynucleotide phosphatase/kinase; hy	95.24
1ojl_A	304	Transcriptional regulatory protein ZRAR; response	95.22
1sxj_B	323	Activator 1 37 kDa subunit; clamp loader, processi	95.22
2dhr_A	499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	95.21
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	95.21
1w5s_A	412	Origin recognition complex subunit 2 ORC2; replica	95.21
3tqf_A	181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	95.18
2p67_A	341	LAO/AO transport system kinase; ARGK, structural G	95.18
2chq_A	319	Replication factor C small subunit; DNA-binding pr	95.17
3pxi_A	758	Negative regulator of genetic competence CLPC/MEC;	95.17
1w1w_A	430	Structural maintenance of chromosome 1; cohesin, c	95.17
3nbx_X	500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	95.16
2zts_A	251	Putative uncharacterized protein PH0186; KAIC like	95.15
2ce7_A	476	Cell division protein FTSH; metalloprotease; HET:	95.15
2o5v_A	359	DNA replication and repair protein RECF; ABC ATPas	95.14
2rdo_7	704	EF-G, elongation factor G; elongation factor G, EF	95.12
4b4t_M	434	26S protease regulatory subunit 6A; hydrolase, AAA	95.11
3avx_A	1289	Elongation factor TS, elongation factor TU, linke	95.08
4aby_A	415	DNA repair protein RECN; hydrolase, double strand	95.07
4f4c_A	1321	Multidrug resistance protein PGP-1; ABC transporte	95.02
4b4t_L	437	26S protease subunit RPT4; hydrolase, AAA-atpases,	95.02
1r6b_X	758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	95.0
1zu4_A	320	FTSY; GTPase, signal recognition particle, SRP, re	95.0
3k1j_A	604	LON protease, ATP-dependent protease LON; ATP-bind	95.0
2c9o_A	456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	94.92
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	94.88
4f4c_A	1321	Multidrug resistance protein PGP-1; ABC transporte	94.88
3ake_A	208	Cytidylate kinase; CMP kinase, CMP complex, open c	94.88
1sky_E	473	F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp	94.84

>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A*

Probab=99.39  E-value=2.9e-13  Score=81.35  Aligned_cols=45  Identities=29%  Similarity=0.268  Sum_probs=28.7

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +...|||+++|++|||||||+.|      |..+.|...|.||++ +|++.+.
T Consensus        10 P~k~~KivlvGd~~VGKTsLi~r------~~~~~f~~~~~~Tig-~d~~~k~   54 (216)
T 4dkx_A           10 PLRKFKLVFLGEQSVGKTSLITR------FMYDSFDNTYQATIG-IDFLSKT   54 (216)
T ss_dssp             ---CEEEEEECSTTSSHHHHHHH------HHHSCCC-----------CEEEE
T ss_pred             CCCcEEEEEECcCCcCHHHHHHH------HHhCCCCCCcCCccc-eEEEEEE
Confidence            34569999999999999999998      999999999999998 6766544

>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A*

Probab=99.08  E-value=1.8e-10  Score=65.76  Aligned_cols=44  Identities=27%  Similarity=0.368  Sum_probs=35.5

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ...+..+||+++|+.++|||||+.+      +..+.+...+.||++ .++.
T Consensus         6 ~~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~~   49 (195)
T 3bc1_A            6 GDYDYLIKFLALGDSGVGKTSVLYQ------YTDGKFNSKFITTVG-IDFR   49 (195)
T ss_dssp             CCCSEEEEEEEECSTTSSHHHHHHH------HHHSCCCCSCCCCCS-EEEE
T ss_pred             cccceeEEEEEECCCCCCHHHHHHH------HhcCCCCcCcccccc-eeee
Confidence            3456789999999999999999997      777777777788887 4444

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*

Probab=99.00  E-value=4.5e-10  Score=66.32  Aligned_cols=45  Identities=36%  Similarity=0.508  Sum_probs=35.2

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ......+||+++|+.+||||||+.+      +..+.|...+.||++  +.+..
T Consensus        22 ~~~~~~~ki~vvG~~~vGKSsL~~~------l~~~~~~~~~~~t~~--~~~~~   66 (214)
T 3q3j_B           22 QPVVARCKLVLVGDVQCGKTAMLQV------LAKDCYPETYVPTVF--ENYTA   66 (214)
T ss_dssp             -----CEEEEEECSTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEE
T ss_pred             CCccceEEEEEECcCCCCHHHHHHH------HhcCCCCCCcCCeee--eeEEE
Confidence            3445679999999999999999998      888888888999998  66653

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*

Probab=98.99  E-value=9.6e-10  Score=64.38  Aligned_cols=43  Identities=28%  Similarity=0.370  Sum_probs=35.2

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ..+..+||+++|+.+||||||+.+      +..+.+...+.||++ +++.
T Consensus        21 ~~~~~~ki~vvG~~~~GKSsLi~~------l~~~~~~~~~~~t~~-~~~~   63 (217)
T 2f7s_A           21 DYDYLIKLLALGDSGVGKTTFLYR------YTDNKFNPKFITTVG-IDFR   63 (217)
T ss_dssp             CCSEEEEEEEESCTTSSHHHHHHH------HHCSCCCCEEEEEEE-EEEE
T ss_pred             CcceeEEEEEECcCCCCHHHHHHH------HhcCCCCcCCCCcee-EEEE
Confidence            346789999999999999999997      777777777888887 4444

>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A*

Probab=98.99  E-value=5.2e-10  Score=64.00  Aligned_cols=30  Identities=27%  Similarity=0.118  Sum_probs=23.5

Q ss_pred             CCCCCCCCCceeeEEEEECCCCChHHHHHh
Q psy15257          1 MLSDNEQPHQELVKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus         1 m~~~~~~~~~~~~kvv~lG~~gvGKTsl~~   30 (65)
                      |+..+.......+||+++|+++||||||+.
T Consensus         3 m~~~~~~~~~~~~ki~vvG~~~~GKssL~~   32 (198)
T 3t1o_A            3 MSTINFANREINFKIVYYGPGLSGKTTNLK   32 (198)
T ss_dssp             -CEEETTTTEEEEEEEEECSTTSSHHHHHH
T ss_pred             ccccchhccccccEEEEECCCCCCHHHHHH
Confidence            344444556778999999999999999993

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}

Probab=98.99  E-value=7.4e-10  Score=63.78  Aligned_cols=42  Identities=21%  Similarity=0.353  Sum_probs=33.0

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ........+||+++|+.+||||||+.+      +..+.+...+.++++
T Consensus        18 ~~~~~~~~~ki~v~G~~~~GKSsLi~~------l~~~~~~~~~~~t~~   59 (193)
T 2oil_A           18 GSEDYNFVFKVVLIGESGVGKTNLLSR------FTRNEFSHDSRTTIG   59 (193)
T ss_dssp             --CCCSEEEEEEEESSTTSSHHHHHHH------HHHSCCCSSCCCCSS
T ss_pred             cccccCcceEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            344567789999999999999999997      776667766777766

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}

Probab=98.98  E-value=5.9e-10  Score=64.39  Aligned_cols=42  Identities=19%  Similarity=0.305  Sum_probs=34.0

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ....+||+++|+.+||||||+.+      +..+.|...+.||++  +.+.
T Consensus        18 ~~~~~ki~vvG~~~vGKTsLi~~------l~~~~~~~~~~~t~~--~~~~   59 (187)
T 3c5c_A           18 GPLEVNLAILGRRGAGKSALTVK------FLTKRFISEYDPNLE--DTYS   59 (187)
T ss_dssp             --CEEEEEEECCTTSSHHHHHHH------HHHSSCCSCCCTTCC--EEEE
T ss_pred             CCceEEEEEECCCCCcHHHHHHH------HHhCCCCcccCCCcc--ceee
Confidence            35679999999999999999997      777778888888887  5544

>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=98.98  E-value=6.4e-10  Score=65.37  Aligned_cols=45  Identities=24%  Similarity=0.282  Sum_probs=35.2

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..++..+||+++|+++||||||+.+      +..+.+...+.||++ .+++.
T Consensus        21 ~~~~~~~ki~lvG~~~vGKSsLi~~------l~~~~~~~~~~~t~~-~~~~~   65 (201)
T 2ew1_A           21 EDYDFLFKIVLIGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFMI   65 (201)
T ss_dssp             -CCSEEEEEEEEESTTSSHHHHHHH------HHHSSCCTTCCCCCS-EEEEE
T ss_pred             cccccceEEEEECcCCCCHHHHHHH------HHhCCCCCCCCCccc-eeEEE
Confidence            3456789999999999999999997      777777777778876 44443

>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A

Probab=98.98  E-value=4.3e-10  Score=63.86  Aligned_cols=41  Identities=24%  Similarity=0.236  Sum_probs=32.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      ..+|++++|+++||||||+.+      +..+.|.. +.||++  +.+...
T Consensus         6 ~~~ki~~vG~~~vGKTsli~~------l~~~~~~~-~~~t~~--~~~~~~   46 (178)
T 2iwr_A            6 PELRLGVLGDARSGKSSLIHR------FLTGSYQV-LEKTES--EQYKKE   46 (178)
T ss_dssp             CEEEEEEECCGGGCHHHHHHH------HHHSCCCC-CSSCSS--SEEEEE
T ss_pred             CceEEEEECCCCCCHHHHHHH------HHhCCCCC-cCCCcc--eeEEEE
Confidence            468999999999999999997      77666665 677776  555443

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*

Probab=98.97  E-value=9.2e-10  Score=63.94  Aligned_cols=45  Identities=22%  Similarity=0.326  Sum_probs=34.6

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ..+..+|++++|++|+|||||+.+      +....+...+.||++ +++...
T Consensus        25 ~~~~~~kv~lvG~~g~GKSTLl~~------l~~~~~~~~~~~t~~-~~~~~~   69 (191)
T 1oix_A           25 EYDYLFKVVLIGDSGVGKSNLLSR------FTRNEFNLESKSTIG-VEFATR   69 (191)
T ss_dssp             CCSEEEEEEEEECTTSSHHHHHHH------HHHSCCCCSCCCCCS-EEEEEE
T ss_pred             ccCcceEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCccc-eEEEEE
Confidence            345679999999999999999997      777777777777776 344333

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8

Probab=98.96  E-value=5.8e-10  Score=64.28  Aligned_cols=44  Identities=45%  Similarity=0.705  Sum_probs=35.4

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+....+|++++|+.+||||||+.+      +..+.|...+.||++  +.+.
T Consensus        13 ~~~~~~~ki~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~--~~~~   56 (194)
T 2atx_A           13 GPGALMLKCVVVGDGAVGKTCLLMS------YANDAFPEEYVPTVF--DHYA   56 (194)
T ss_dssp             CCEEEEEEEEEEECTTSSHHHHHHH------HHHSSCCCSCCCSSC--CCEE
T ss_pred             CCCCceEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc--ceeE
Confidence            3445779999999999999999997      777777777888876  5554

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}

Probab=98.96  E-value=6.3e-10  Score=65.54  Aligned_cols=41  Identities=34%  Similarity=0.525  Sum_probs=28.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ...+||+++|++|||||||+.+      +..+.+...+.||++  +.+.
T Consensus        32 ~~~~ki~vvG~~~vGKSsli~~------l~~~~~~~~~~~t~~--~~~~   72 (214)
T 2j1l_A           32 VRSVKVVLVGDGGCGKTSLLMV------FADGAFPESYTPTVF--ERYM   72 (214)
T ss_dssp             CCEEEEEEEECTTSSHHHHHHH------HHC-------CCCCC--EEEE
T ss_pred             cceEEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCccc--eeEE
Confidence            4579999999999999999997      777777777888876  5544

>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*

Probab=98.95  E-value=8.7e-10  Score=62.19  Aligned_cols=43  Identities=30%  Similarity=0.312  Sum_probs=33.0

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ....+|++++|+.++|||||+.+      +..+.+...+.|+++ .+++.
T Consensus        11 ~~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~~~-~~~~~   53 (179)
T 2y8e_A           11 PLRKFKLVFLGEQSVGKTSLITR------FMYDSFDNTYQATIG-IDFLS   53 (179)
T ss_dssp             -CEEEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCCS-EEEEE
T ss_pred             CCcceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee-eEEEE
Confidence            34569999999999999999997      666677777777776 44433

>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A*

Probab=98.95  E-value=5.1e-10  Score=63.81  Aligned_cols=38  Identities=29%  Similarity=0.407  Sum_probs=18.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+..+||+++|+.+||||||+.+      +..+.+...+.||++
T Consensus         5 ~~~~~ki~v~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   42 (183)
T 2fu5_C            5 YDYLFKLLLIGDSGVGKTCVLFR------FSEDAFNSTFISTIG   42 (183)
T ss_dssp             CSEEEEEEEECCCCC----------------------CHHHHHC
T ss_pred             cCCceEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc
Confidence            45789999999999999999997      777777777777776

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8

Probab=98.95  E-value=7.7e-10  Score=65.11  Aligned_cols=44  Identities=34%  Similarity=0.493  Sum_probs=34.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .....+||+++|+.+||||||+.+      +..+.|...+.||++  +.+..
T Consensus        24 ~~~~~~ki~vvG~~~vGKSsLi~~------l~~~~~~~~~~~t~~--~~~~~   67 (205)
T 1gwn_A           24 NQNVKCKIVVVGDSQCGKTALLHV------FAKDCFPENYVPTVF--ENYTA   67 (205)
T ss_dssp             ---CEEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEE
T ss_pred             ccceeeEEEEECCCCCCHHHHHHH------HhcCCCCCCcCCccc--eeEEE
Confidence            345679999999999999999997      777788888889988  55543

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*

Probab=98.93  E-value=1.1e-09  Score=62.91  Aligned_cols=43  Identities=35%  Similarity=0.512  Sum_probs=34.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ....+|++++|+++||||||+.+      +..+.|...+.||++  +.+..
T Consensus         4 ~~~~~ki~v~G~~~vGKSsli~~------l~~~~~~~~~~~t~~--~~~~~   46 (184)
T 1m7b_A            4 QNVKCKIVVVGDSQCGKTALLHV------FAKDCFPENYVPTVF--ENYTA   46 (184)
T ss_dssp             --CEEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEE
T ss_pred             CceEEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc--eeEEE
Confidence            34579999999999999999997      777778888889988  55543

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*

Probab=98.93  E-value=1.9e-09  Score=62.15  Aligned_cols=43  Identities=44%  Similarity=0.607  Sum_probs=35.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ....+|++++|+++||||||+.+      +..+.+...+.||++  +.+..
T Consensus        20 ~~~~~ki~~vG~~~~GKSsl~~~------l~~~~~~~~~~~t~~--~~~~~   62 (194)
T 3reg_A           20 GKKALKIVVVGDGAVGKTCLLLA------FSKGEIPTAYVPTVF--ENFSH   62 (194)
T ss_dssp             -CEEEEEEEECSTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEE
T ss_pred             cceeeEEEEECcCCCCHHHHHHH------HhcCCCCCccCCeee--eeeEE
Confidence            45679999999999999999997      777778888889988  55554

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}

Probab=98.93  E-value=1.2e-09  Score=63.77  Aligned_cols=44  Identities=27%  Similarity=0.347  Sum_probs=26.6

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      +......+||+++|+.+||||+|+.+      +..+.|...+.||++ .++
T Consensus        23 ~~~~~~~~ki~vvG~~~vGKSsli~~------l~~~~~~~~~~~t~~-~~~   66 (201)
T 2hup_A           23 DEQYDFLFKLVLVGDASVGKTCVVQR------FKTGAFSERQGSTIG-VDF   66 (201)
T ss_dssp             ---CCEEEEEEEEECTTSSHHHHHHH------HHHSCC-----------CE
T ss_pred             ccccccceEEEEECcCCCCHHHHHHH------HhhCCCCCCCCCCcc-eEE
Confidence            34456789999999999999999997      777777777888876 344

>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A*

Probab=98.92  E-value=2.4e-09  Score=61.01  Aligned_cols=44  Identities=18%  Similarity=0.215  Sum_probs=34.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..+..+||+++|+.++|||||+.+      +..+.+...+.|+++ .+++.
T Consensus         6 ~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~-~~~~~   49 (186)
T 2bme_A            6 TYDFLFKFLVIGNAGTGKSCLLHQ------FIEKKFKDDSNHTIG-VEFGS   49 (186)
T ss_dssp             CCSEEEEEEEEESTTSSHHHHHHH------HHHSSCCTTCCCCSE-EEEEE
T ss_pred             ccccceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc-eEEEE
Confidence            346789999999999999999997      777777777777776 34433

>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ...

Probab=98.91  E-value=9.3e-10  Score=64.80  Aligned_cols=43  Identities=26%  Similarity=0.238  Sum_probs=34.5

Q ss_pred             CCCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         4 ~~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +........+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus         7 ~~~~~~~~~~ki~v~G~~~~GKSsli~~------~~~~~~~~~~~~t~~   49 (221)
T 3gj0_A            7 AAQGEPQVQFKLVLVGDGGTGKTTFVKR------HLTGEFEKKYVATLG   49 (221)
T ss_dssp             CSTTCCCCEEEEEEEECTTSSHHHHHTT------BHHHHHTCEEETTTT
T ss_pred             ccCCCcccceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            3444556789999999999999999997      777777777777765

>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A*

Probab=98.91  E-value=1.6e-09  Score=61.13  Aligned_cols=39  Identities=36%  Similarity=0.407  Sum_probs=32.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +....+|++++|+.|+|||||+.+      +..+.+...+.||++
T Consensus         5 ~~~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~   43 (181)
T 2fn4_A            5 PPSETHKLVVVGGGGVGKSALTIQ------FIQSYFVSDYDPTIE   43 (181)
T ss_dssp             CSSCEEEEEEEECTTSSHHHHHHH------HHHSSCCSSCCTTCC
T ss_pred             CCCCceEEEEECCCCCCHHHHHHH------HHhCcCccccCCCcC
Confidence            345679999999999999999997      766677777778776

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0

Probab=98.91  E-value=2.2e-09  Score=62.00  Aligned_cols=39  Identities=18%  Similarity=0.190  Sum_probs=32.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+|++++|++|||||||+.+      +..+.|...+.||.+
T Consensus        16 ~~~~~~ki~ivG~~~vGKSsL~~~------~~~~~~~~~~~~t~~   54 (184)
T 3ihw_A           16 FQGPELKVGIVGNLSSGKSALVHR------YLTGTYVQEESPEGG   54 (184)
T ss_dssp             CCCCEEEEEEECCTTSCHHHHHHH------HHHSSCCCCCCTTCE
T ss_pred             CCCCeeEEEEECCCCCCHHHHHHH------HhcCCCCCCcCCCcc
Confidence            345679999999999999999997      777777777777744

>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A*

Probab=98.90  E-value=2e-09  Score=61.29  Aligned_cols=39  Identities=31%  Similarity=0.313  Sum_probs=32.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+||+++|+.++|||+|+.+      +..+.+...+.|+++
T Consensus        14 ~~~~~~ki~v~G~~~~GKSsl~~~------l~~~~~~~~~~~t~~   52 (183)
T 3kkq_A           14 ENLPTYKLVVVGDGGVGKSALTIQ------FFQKIFVDDYDPTIE   52 (183)
T ss_dssp             CCCCEEEEEEECSTTSSHHHHHHH------HHHSCCCSCCCTTCC
T ss_pred             cCCCceEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCCcc
Confidence            345679999999999999999997      777777777777776

>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A*

Probab=98.90  E-value=7.7e-10  Score=62.60  Aligned_cols=37  Identities=30%  Similarity=0.293  Sum_probs=30.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|+++||||||+.+      +..+.+...+.||++
T Consensus         4 ~~~~ki~v~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   40 (178)
T 2hxs_A            4 MRQLKIVVLGDGASGKTSLTTC------FAQETFGKQYKQTIG   40 (178)
T ss_dssp             CCEEEEEEECCTTSSHHHHHHH------HHGGGTTHHHHHTTT
T ss_pred             CceEEEEEECcCCCCHHHHHHH------HHhCcCCCCCCCcee
Confidence            4569999999999999999997      666666666667665

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*

Probab=98.89  E-value=2e-09  Score=62.55  Aligned_cols=37  Identities=27%  Similarity=0.434  Sum_probs=28.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +..+|++++|++|+|||||+.+      +....+...+.||++
T Consensus         3 ~~~~kv~lvG~~g~GKSTLl~~------l~~~~~~~~~~~t~~   39 (199)
T 2f9l_A            3 DYLFKVVLIGDSGVGKSNLLSR------FTRNEFNLESKSTIG   39 (199)
T ss_dssp             SEEEEEEEESSTTSSHHHHHHH------HHHSCCCC---CCCS
T ss_pred             cceEEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            5679999999999999999997      666666666666654

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}

Probab=98.89  E-value=1.9e-09  Score=62.32  Aligned_cols=41  Identities=22%  Similarity=0.323  Sum_probs=26.7

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+....+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus        20 p~~~~~~~ki~vvG~~~~GKSsLi~~------l~~~~~~~~~~~t~~   60 (192)
T 2il1_A           20 PRPADFKLQVIIIGSRGVGKTSLMER------FTDDTFCEACKSTVG   60 (192)
T ss_dssp             --CCSEEEEEEEECSTTSSHHHHHHH------HCC--------CCTT
T ss_pred             CcccCCceEEEEECCCCCCHHHHHHH------HhcCCCCcCCCCccc
Confidence            44556789999999999999999997      776777666667665

>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B*

Probab=98.89  E-value=1.8e-09  Score=61.14  Aligned_cols=41  Identities=22%  Similarity=0.270  Sum_probs=30.4

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +......+|++++|+.++|||+|+.+      +..+.+...+.++++
T Consensus         6 ~~~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   46 (181)
T 2efe_B            6 AGNKSINAKLVLLGDVGAGKSSLVLR------FVKDQFVEFQESTIG   46 (181)
T ss_dssp             ----CEEEEEEEECCTTSCHHHHHHH------HHHCCCTTTSCCCSC
T ss_pred             CCCCccceEEEEECcCCCCHHHHHHH------HHcCCCCCcCCCCce
Confidence            34456779999999999999999997      666666666666665

>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens}

Probab=98.89  E-value=2.9e-09  Score=60.11  Aligned_cols=39  Identities=23%  Similarity=0.392  Sum_probs=29.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|++++|||||+.+      +..+.+...+.|+++
T Consensus         5 ~~~~~~~i~v~G~~~~GKssl~~~------l~~~~~~~~~~~~~~   43 (181)
T 3tw8_B            5 DYDHLFKLLIIGDSGVGKSSLLLR------FADNTFSGSYITTIG   43 (181)
T ss_dssp             -CCEEEEEEEECCTTSCHHHHHHH------HCSCC---CCTTTBS
T ss_pred             ccCcceEEEEECCCCCCHHHHHHH------HhcCCCCCccCCCce
Confidence            456779999999999999999997      776666666666665

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*

Probab=98.89  E-value=2.8e-09  Score=60.19  Aligned_cols=38  Identities=26%  Similarity=0.374  Sum_probs=28.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|++|+|||||+.+      +..+.+...+.|+++
T Consensus         4 ~~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   41 (177)
T 1wms_A            4 KSSLFKVILLGDGGVGKSSLMNR------YVTNKFDTQLFHTIG   41 (177)
T ss_dssp             CEEEEEEEEECCTTSSHHHHHHH------HHHSCCCC----CCS
T ss_pred             ccceeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee
Confidence            45679999999999999999997      776677777777776

>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A*

Probab=98.89  E-value=2.4e-09  Score=60.33  Aligned_cols=40  Identities=20%  Similarity=0.333  Sum_probs=31.7

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ......+|++++|+.++|||||+.+      +..+.+...+.+|++
T Consensus        10 ~~~~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   49 (179)
T 1z0f_A           10 YNYSYIFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG   49 (179)
T ss_dssp             -CCSEEEEEEEECSTTSSHHHHHHH------HHHSCCCSSCTTSCC
T ss_pred             cccccceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            3456789999999999999999997      666666666666665

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana}

Probab=98.89  E-value=1.7e-09  Score=63.17  Aligned_cols=42  Identities=38%  Similarity=0.710  Sum_probs=34.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ...+|++++|+.+||||+|+.+      +..+.|...+.||++  +.+..
T Consensus         7 ~~~~ki~i~G~~~~GKTsli~~------l~~~~~~~~~~~t~~--~~~~~   48 (212)
T 2j0v_A            7 SKFIKCVTVGDGAVGKTCMLIC------YTSNKFPTDYIPTVF--DNFSA   48 (212)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCSSC--CCEEE
T ss_pred             CceEEEEEECCCCCCHHHHHHH------HhcCCCCccCCCccc--eeEEE
Confidence            3569999999999999999997      777777778888887  55543

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=98.89  E-value=1.9e-09  Score=62.36  Aligned_cols=41  Identities=27%  Similarity=0.398  Sum_probs=32.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ...+||+++|+.+||||||+.+      +..+.+...+.||++  +.+.
T Consensus        26 ~~~~ki~v~G~~~vGKSsli~~------l~~~~~~~~~~~t~~--~~~~   66 (196)
T 2atv_A           26 SAEVKLAIFGRAGVGKSALVVR------FLTKRFIWEYDPTLE--STYR   66 (196)
T ss_dssp             -CCEEEEEECCTTSSHHHHHHH------HHHSCCCSCCCTTCC--EEEE
T ss_pred             CCceEEEEECCCCCCHHHHHHH------HHhCCCCcccCCCCC--ceEE
Confidence            4568999999999999999997      777777777788877  4443

>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927}

Probab=98.88  E-value=1.7e-09  Score=62.18  Aligned_cols=40  Identities=25%  Similarity=0.222  Sum_probs=29.3

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccc-cccceEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT-THVPTVW   52 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~-~~~~ti~   52 (65)
                      .+....+||+++|+.+||||||+.+      +..+.+.. .+.||++
T Consensus        12 ~~~~~~~ki~v~G~~~~GKSsl~~~------l~~~~~~~~~~~~t~~   52 (199)
T 4bas_A           12 GQSKTKLQVVMCGLDNSGKTTIINQ------VKPAQSSSKHITATVG   52 (199)
T ss_dssp             ----CEEEEEEECCTTSCHHHHHHH------HSCCC----CCCCCSS
T ss_pred             cCCCCCcEEEEECCCCCCHHHHHHH------HhcCCCcccccccccc
Confidence            4456779999999999999999997      77777777 7788876

>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae}

Probab=98.88  E-value=1.9e-09  Score=63.69  Aligned_cols=39  Identities=26%  Similarity=0.385  Sum_probs=27.5

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|+.+||||+|+.+      +..+.+...+.||++
T Consensus         9 ~~~~~~ki~v~G~~~vGKSsli~~------l~~~~~~~~~~~t~~   47 (223)
T 3cpj_B            9 DYDLLFKIVLIGDSGVGKSNLLSR------FTKNEFNMDSKSTIG   47 (223)
T ss_dssp             -CCEEEEEEEESCTTSSHHHHHHH------HHHCCCCC------C
T ss_pred             CCCeeeEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            346789999999999999999997      776677766777776

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*

Probab=98.88  E-value=1.3e-09  Score=61.60  Aligned_cols=43  Identities=23%  Similarity=0.359  Sum_probs=30.2

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ....+|++++|++|+|||||+.+      +..+.+...+.|+++ .+++.
T Consensus         5 ~~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~-~~~~~   47 (182)
T 1ky3_A            5 KKNILKVIILGDSGVGKTSLMHR------YVNDKYSQQYKATIG-ADFLT   47 (182)
T ss_dssp             --CEEEEEEECCTTSSHHHHHHH------HHHSCCCTTC---CC-CSCEE
T ss_pred             cCceEEEEEECCCCCCHHHHHHH------HHhCcCCcccCCccc-eEEEE
Confidence            45679999999999999999997      666667777777775 34443

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*

Probab=98.88  E-value=3e-09  Score=59.38  Aligned_cols=40  Identities=33%  Similarity=0.410  Sum_probs=33.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|++++|||||+.+      +..+.+...+.||++  +.+..
T Consensus         3 ~~ki~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~--~~~~~   42 (167)
T 1c1y_A            3 EYKLVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYRK   42 (167)
T ss_dssp             EEEEEEECSTTSSHHHHHHH------HHHCCCCCSCCCCSE--EEEEE
T ss_pred             eeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCCcc--ceEEE
Confidence            58999999999999999997      777777788888888  55543

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}

Probab=98.88  E-value=2.1e-09  Score=62.65  Aligned_cols=39  Identities=21%  Similarity=0.216  Sum_probs=23.4

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus        21 ~~~~~~ki~v~G~~~~GKSsLi~~------l~~~~~~~~~~~t~~   59 (200)
T 2o52_A           21 WSDFLFKFLVIGSAGTGKSCLLHQ------FIENKFKQDSNHTIG   59 (200)
T ss_dssp             -CCEEEEEEEEESTTSSHHHHHHH------HHC------------
T ss_pred             ccCcceEEEEECcCCCCHHHHHHH------HHhCCCCccCCCccc
Confidence            446789999999999999999997      777777777777776

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}

Probab=98.87  E-value=1.7e-09  Score=62.63  Aligned_cols=43  Identities=40%  Similarity=0.642  Sum_probs=26.5

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .....+||+++|+.+||||||+.+      +..+.|...+.||++  +.+.
T Consensus        16 ~~~~~~ki~~~G~~~~GKssl~~~------l~~~~~~~~~~~t~~--~~~~   58 (201)
T 2q3h_A           16 AEGRGVKCVLVGDGAVGKTSLVVS------YTTNGYPTEYIPTAF--DNFS   58 (201)
T ss_dssp             ----CEEEEEECSTTSSHHHHHHH------HHC--------CCSS--EEEE
T ss_pred             CCCcceEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc--ceeE
Confidence            345679999999999999999997      776777777888876  5544

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*

Probab=98.87  E-value=3.8e-09  Score=60.87  Aligned_cols=41  Identities=27%  Similarity=0.353  Sum_probs=29.0

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +......+|++++|+.+||||||+.+      +..+.+...+.|+++
T Consensus        15 ~~~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   55 (191)
T 2a5j_A           15 VPRGSYLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG   55 (191)
T ss_dssp             CCTTCEEEEEEEESSTTSSHHHHHHH------HHHSCCCC-----CC
T ss_pred             ccccCcceEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            34556789999999999999999997      666666666666655

>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8

Probab=98.87  E-value=4.6e-09  Score=60.81  Aligned_cols=39  Identities=23%  Similarity=0.366  Sum_probs=32.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus         4 ~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   42 (203)
T 1zbd_A            4 MFDYMFKILIIGNSSVGKTSFLFR------YADDSFTPAFVSTVG   42 (203)
T ss_dssp             SCSEEEEEEEECSTTSSHHHHHHH------HHTCCCCSCCCCCCS
T ss_pred             ccceeeEEEEECCCCCCHHHHHHH------HhcCCCCCCcCCccc
Confidence            345789999999999999999997      777777777777776

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*

Probab=98.86  E-value=2e-09  Score=60.12  Aligned_cols=37  Identities=30%  Similarity=0.325  Sum_probs=30.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|+|||||+.+      +..+.+...+.||++
T Consensus         3 ~~~~~i~v~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   39 (168)
T 1z2a_A            3 EVAIKMVVVGNGAVGKSSMIQR------YCKGIFTKDYKKTIG   39 (168)
T ss_dssp             -CEEEEEEECSTTSSHHHHHHH------HHHCCCCCCSSCCCS
T ss_pred             ceeEEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCceE
Confidence            4578999999999999999997      666667667777765

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*

Probab=98.86  E-value=1.4e-09  Score=62.58  Aligned_cols=40  Identities=33%  Similarity=0.338  Sum_probs=24.0

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhcccccc--ccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSL--SQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~--~~~~~~~~~ti~~vd~~~   58 (65)
                      .+|++++|++|||||||+.+      +..  ..+...+.||++ +++..
T Consensus         2 ~~kv~ivG~~gvGKStLl~~------l~~~~~~~~~~~~~t~g-~~~~~   43 (184)
T 2zej_A            2 RMKLMIVGNTGSGKTTLLQQ------LMKTKKSDLGMQSATVG-IDVKD   43 (184)
T ss_dssp             -CEEEEESCTTSSHHHHHHH------HTCC-----------CS-EEEEE
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCCccCCCcceecc-EEeEE
Confidence            47999999999999999997      655  356667788887 55543

>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A*

Probab=98.86  E-value=2.6e-09  Score=59.87  Aligned_cols=38  Identities=26%  Similarity=0.372  Sum_probs=30.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|++++|||||+.+      +..+.+...+.|+++
T Consensus         3 ~~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~   40 (170)
T 1z08_A            3 RAYSFKVVLLGEGCVGKTSLVLR------YCENKFNDKHITTLG   40 (170)
T ss_dssp             -CEEEEEEEECCTTSCHHHHHHH------HHHCCCCSSCCCCCS
T ss_pred             CCcceEEEEECcCCCCHHHHHHH------HHcCCCCcCCCCccc
Confidence            35679999999999999999997      666667666777766

>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B*

Probab=98.86  E-value=2.8e-09  Score=61.72  Aligned_cols=43  Identities=26%  Similarity=0.362  Sum_probs=33.1

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ....+|++++|+.++|||||+.+      +....+...+.|+++ .+++.
T Consensus         5 ~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~~~   47 (207)
T 1vg8_A            5 KKVLLKVIILGDSGVGKTSLMNQ------YVNKKFSNQYKATIG-ADFLT   47 (207)
T ss_dssp             --CEEEEEEECCTTSSHHHHHHH------HHHSCCCSSCCCCCS-EEEEE
T ss_pred             cCcceEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCccc-ceEEE
Confidence            45679999999999999999997      777777777778776 34444

>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A*

Probab=98.86  E-value=2.4e-09  Score=62.25  Aligned_cols=38  Identities=24%  Similarity=0.329  Sum_probs=31.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+..+||+++|+.++|||||+.+      +..+.+...+.|+++
T Consensus         5 ~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   42 (206)
T 2bcg_Y            5 YDYLFKLLLIGNSGVGKSCLLLR------FSDDTYTNDYISTIG   42 (206)
T ss_dssp             CSEEEEEEEEESTTSSHHHHHHH------HHHCCCCTTCCCSSC
T ss_pred             cCcceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            46789999999999999999997      766667777777765

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*

Probab=98.85  E-value=2.6e-09  Score=62.46  Aligned_cols=44  Identities=41%  Similarity=0.650  Sum_probs=34.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ...+||+++|+.+||||||+.+      +..+.+...+.||++  +.+...+
T Consensus        28 ~~~~ki~vvG~~~~GKSsLi~~------l~~~~~~~~~~~t~~--~~~~~~~   71 (204)
T 4gzl_A           28 GQAIKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYSANV   71 (204)
T ss_dssp             --CEEEEEEESTTSSHHHHHHH------HHHSCCCC-CCCCSE--EEEEEEE
T ss_pred             CCeEEEEEECcCCCCHHHHHHH------HHhCCCCCCcCCeec--ceeEEEE
Confidence            4568999999999999999997      777788888888887  6655443

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ...

Probab=98.84  E-value=4.4e-09  Score=59.67  Aligned_cols=40  Identities=45%  Similarity=0.756  Sum_probs=32.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..+|++++|++++|||||+.+      +..+.+...+.||++  +.+.
T Consensus         4 ~~~~i~~~G~~~~GKssl~~~------l~~~~~~~~~~~t~~--~~~~   43 (186)
T 1mh1_A            4 QAIKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYS   43 (186)
T ss_dssp             EEEEEEEECSTTSSHHHHHHH------HHHSSCCSSCCCCSC--CEEE
T ss_pred             cEEEEEEECCCCCCHHHHHHH------HHcCCCCCCcCCccc--ceeE
Confidence            568999999999999999997      776777777777776  5444

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*

Probab=98.84  E-value=6.6e-09  Score=59.66  Aligned_cols=40  Identities=23%  Similarity=0.361  Sum_probs=32.4

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+..+||+++|+.++|||+|+.+      +..+.+...+.|+++
T Consensus        17 ~~~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   56 (189)
T 2gf9_A           17 RGSDYMFKLLLIGNSSVGKTSFLFR------YADDSFTPAFVSTVG   56 (189)
T ss_dssp             TTCSEEEEEEEECSTTSSHHHHHHH------HHHSCCCCSCCCCCC
T ss_pred             cccCceeEEEEECCCCCCHHHHHHH------HHcCCCCCCcCCcee
Confidence            3456779999999999999999997      766667666777766

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*

Probab=98.84  E-value=4.1e-09  Score=58.61  Aligned_cols=35  Identities=29%  Similarity=0.368  Sum_probs=29.8

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+.++|||||+.+      +..+.+...+.|+++
T Consensus         3 ~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   37 (167)
T 1kao_A            3 EYKVVVLGSGGVGKSALTVQ------FVTGTFIEKYDPTIE   37 (167)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHHSCCCSCCCTTCC
T ss_pred             EEEEEEECCCCCCHHHHHHH------HHcCCCcccCCCCcc
Confidence            58999999999999999997      776777777777776

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*

Probab=98.84  E-value=6.2e-09  Score=58.21  Aligned_cols=38  Identities=24%  Similarity=0.323  Sum_probs=31.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|+.++|||||+.+      +..+.+...+.|+++
T Consensus         3 ~~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   40 (170)
T 1z0j_A            3 ALRELKVCLLGDTGVGKSSIMWR------FVEDSFDPNINPTIG   40 (170)
T ss_dssp             SEEEEEEEEECCTTSSHHHHHHH------HHHSCCCTTCCCCCS
T ss_pred             CCcceEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCcee
Confidence            35679999999999999999997      776677666777766

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}

Probab=98.84  E-value=2.5e-09  Score=62.31  Aligned_cols=24  Identities=29%  Similarity=0.570  Sum_probs=19.9

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +....+||+++|+++||||||+.+
T Consensus        19 ~~~~~~ki~vvG~~~vGKSsLi~~   42 (195)
T 3cbq_A           19 QKDGIFKVMLVGESGVGKSTLAGT   42 (195)
T ss_dssp             ---CEEEEEEECSTTSSHHHHHHH
T ss_pred             CCCcEEEEEEECCCCCCHHHHHHH
Confidence            446679999999999999999997

>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens}

Probab=98.83  E-value=4.8e-09  Score=60.57  Aligned_cols=42  Identities=31%  Similarity=0.449  Sum_probs=33.3

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ....+||+++|+.|+|||+|+.+      +..+.+...+.||++  +.+.
T Consensus        11 ~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~--~~~~   52 (206)
T 2bov_A           11 SLALHKVIMVGSGGVGKSALTLQ------FMYDEFVEDYEPTKA--DSYR   52 (206)
T ss_dssp             CCCEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCTTCC--EEEE
T ss_pred             CCceEEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc--eEEE
Confidence            34568999999999999999997      766667777777776  4443

>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A*

Probab=98.83  E-value=4.2e-09  Score=59.85  Aligned_cols=41  Identities=22%  Similarity=0.337  Sum_probs=33.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ...+|++++|+.+||||+|+.+      +..+.+...+.||++  +.+.
T Consensus         4 ~~~~ki~~~G~~~~GKSsli~~------l~~~~~~~~~~~t~~--~~~~   44 (181)
T 3t5g_A            4 SKSRKIAILGYRSVGKSSLTIQ------FVEGQFVDSYDPTIE--NTFT   44 (181)
T ss_dssp             EEEEEEEEEESTTSSHHHHHHH------HHHSSCCSCCCTTCC--EEEE
T ss_pred             CceEEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCCcc--ccEE
Confidence            4578999999999999999997      777777778888877  4443

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8

Probab=98.83  E-value=3.6e-09  Score=61.12  Aligned_cols=40  Identities=25%  Similarity=0.434  Sum_probs=31.5

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+...+||+++|+.++|||||+.+      +..+.+...+.|+++
T Consensus        18 ~~~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~~~~   57 (192)
T 2fg5_A           18 GSAIRELKVCLLGDTGVGKSSIVCR------FVQDHFDHNISPTIG   57 (192)
T ss_dssp             ---CEEEEEEEEECTTSSHHHHHHH------HHHCCCCTTCCCCSS
T ss_pred             cccCCceEEEEECcCCCCHHHHHHH------HhcCCCCCCcCCCcc
Confidence            3456789999999999999999997      776677767777776

>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8

Probab=98.82  E-value=5.8e-09  Score=59.67  Aligned_cols=38  Identities=18%  Similarity=0.296  Sum_probs=31.5

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+||+++|+.+||||+|+.+      +..+.+...+.|+++
T Consensus        12 ~~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~   49 (195)
T 1x3s_A           12 VLTTLKILIIGESGVGKSSLLLR------FTDDTFDPELAATIG   49 (195)
T ss_dssp             EEEEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCCS
T ss_pred             CCCceEEEEECCCCCCHHHHHHH------HHcCCCCccCCCccc
Confidence            34579999999999999999997      777777777777765

>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens}

Probab=98.82  E-value=6.9e-09  Score=59.49  Aligned_cols=39  Identities=23%  Similarity=0.336  Sum_probs=31.6

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+||+++|+.++|||+|+.+      +..+.+...+.|+++
T Consensus        12 ~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   50 (196)
T 3tkl_A           12 EYDYLFKLLLIGDSGVGKSCLLLR------FADDTYTESYISTIG   50 (196)
T ss_dssp             CCSEEEEEEEECSTTSSHHHHHHH------HHHSCCCSCCCCCSS
T ss_pred             ccccceEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            345779999999999999999997      766677766666665

>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A*

Probab=98.82  E-value=5.6e-09  Score=58.28  Aligned_cols=37  Identities=27%  Similarity=0.310  Sum_probs=30.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|+.++|||||+.+      +..+.+...+.|+++
T Consensus         4 ~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~~~   40 (170)
T 1r2q_A            4 ICQFKLVLLGESAVGKSSLVLR------FVKGQFHEFQESTIG   40 (170)
T ss_dssp             EEEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCSS
T ss_pred             CceEEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            4679999999999999999997      666666666666665

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*

Probab=98.82  E-value=4.8e-09  Score=60.40  Aligned_cols=37  Identities=27%  Similarity=0.354  Sum_probs=31.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.+||||||+.+      +..+.+...+.||++
T Consensus        20 ~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   56 (188)
T 1zd9_A           20 KEEMELTLVGLQYSGKTTFVNV------IASGQFNEDMIPTVG   56 (188)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHH------HHHSCCCCSCCCCCS
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HHcCCCCCccCCCCc
Confidence            4579999999999999999997      777777777888887

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8

Probab=98.82  E-value=3.6e-09  Score=63.08  Aligned_cols=24  Identities=25%  Similarity=0.479  Sum_probs=20.4

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+||+++|+++||||||+.+
T Consensus        33 ~~~~~~kVvlvG~~~vGKSSLl~r   56 (211)
T 2g3y_A           33 SGNTYYRVVLIGEQGVGKSTLANI   56 (211)
T ss_dssp             --CCEEEEEEECCTTSSHHHHHHH
T ss_pred             cCCCceEEEEECCCCCCHHHHHHH
Confidence            345679999999999999999997

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*

Probab=98.81  E-value=4.2e-09  Score=60.50  Aligned_cols=37  Identities=27%  Similarity=0.394  Sum_probs=30.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.++|||||+.+      +..+.+...+.|+++
T Consensus        18 ~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   54 (189)
T 1z06_A           18 SRIFKIIVIGDSNVGKTCLTYR------FCAGRFPDRTEATIG   54 (189)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHH------HHHSSCCSSCCCCCS
T ss_pred             CceEEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCCcc
Confidence            4569999999999999999997      776677766777765

>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum}

Probab=98.81  E-value=3.8e-09  Score=60.31  Aligned_cols=45  Identities=16%  Similarity=0.244  Sum_probs=35.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ...+||+++|+.++|||||+.+      +....+...+.||++ .+++...+
T Consensus         5 ~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~~~~~~   49 (208)
T 3clv_A            5 KSSYKTVLLGESSVGKSSIVLR------LTKDTFHENTNTTIG-ASFCTYVV   49 (208)
T ss_dssp             CSSEEEEEECCTTSSHHHHHHH------HHHSCCCSSCCCCCS-CEEEEEEE
T ss_pred             CcceEEEEECCCCCCHHHHHHH------HHhCcCCCCcCcccc-ceeEEEEE
Confidence            3568999999999999999997      777777788888887 34444433

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=98.81  E-value=1.8e-09  Score=62.25  Aligned_cols=39  Identities=23%  Similarity=0.374  Sum_probs=32.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus        19 ~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   57 (191)
T 3dz8_A           19 NFDYMFKLLIIGNSSVGKTSFLFR------YADDTFTPAFVSTVG   57 (191)
T ss_dssp             EEEECEEEEEEESTTSSHHHHHHH------HHHHTTCCCEEEEET
T ss_pred             ccCeeeEEEEECCCCcCHHHHHHH------HhcCCCCcccCCCee
Confidence            446779999999999999999997      777777777777776

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=98.81  E-value=6.3e-09  Score=58.06  Aligned_cols=36  Identities=25%  Similarity=0.446  Sum_probs=29.7

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+.|+|||||+.+      +..+.+...+.|+++
T Consensus         2 ~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~~~   37 (170)
T 1ek0_A            2 TSIKLVLLGEAAVGKSSIVLR------FVSNDFAENKEPTIG   37 (170)
T ss_dssp             EEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCSS
T ss_pred             ceEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            358999999999999999997      666667666777766

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}

Probab=98.81  E-value=4.8e-09  Score=60.88  Aligned_cols=39  Identities=26%  Similarity=0.354  Sum_probs=24.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+||+++|+.+||||||+.+      +..+.|...+.|+++
T Consensus        24 ~~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   62 (199)
T 2p5s_A           24 SSQKAYKIVLAGDAAVGKSSFLMR------LCKNEFRENISATLG   62 (199)
T ss_dssp             ----CEEEEEESSTTSSHHHHHHH------HHHCCCC--------
T ss_pred             CcCCCeEEEEECcCCCCHHHHHHH------HHhCCCCccCCCCcc
Confidence            345579999999999999999997      766667666777776

>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A*

Probab=98.79  E-value=6.8e-09  Score=58.83  Aligned_cols=37  Identities=27%  Similarity=0.355  Sum_probs=30.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.++|||+|+.+      +..+.+...+.||++
T Consensus        16 ~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   52 (187)
T 2a9k_A           16 LALHKVIMVGSGGVGKSALTLQ------FMYDEFVEDYEPTKA   52 (187)
T ss_dssp             -CEEEEEEECSTTSSHHHHHHH------HHHSCCCCSCCTTCC
T ss_pred             CCceEEEEECCCCCCHHHHHHH------HhhCCCCCcCCCccc
Confidence            4569999999999999999997      666667777777776

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8

Probab=98.79  E-value=8e-09  Score=57.73  Aligned_cols=36  Identities=25%  Similarity=0.335  Sum_probs=29.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+.|+|||||+.+      +..+.+...+.|+++
T Consensus         2 ~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~t~~   37 (172)
T 2erx_A            2 NDYRVAVFGAGGVGKSSLVLR------FVKGTFRESYIPTVE   37 (172)
T ss_dssp             CEEEEEEECCTTSSHHHHHHH------HHTCCCCSSCCCCSC
T ss_pred             CceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCCcc
Confidence            358999999999999999997      666667666777776

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}

Probab=98.79  E-value=5.2e-09  Score=60.78  Aligned_cols=38  Identities=29%  Similarity=0.256  Sum_probs=32.1

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|+.+||||||+.+      +..+.+...+.||++
T Consensus        21 ~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   58 (201)
T 3oes_A           21 LVRYRKVVILGYRCVGKTSLAHQ------FVEGEFSEGYDPTVE   58 (201)
T ss_dssp             --CEEEEEEEESTTSSHHHHHHH------HHHSCCCSCCCCCSE
T ss_pred             CCCcEEEEEECCCCcCHHHHHHH------HHhCCCCCCCCCccc
Confidence            34579999999999999999997      777778888888887

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*

Probab=98.78  E-value=9.4e-09  Score=57.14  Aligned_cols=36  Identities=28%  Similarity=0.380  Sum_probs=29.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+.|+|||||+.+      +..+.+...+.||++
T Consensus         3 ~~~~i~v~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   38 (168)
T 1u8z_A            3 ALHKVIMVGSGGVGKSALTLQ------FMYDEFVEDYEPTKA   38 (168)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH------HHHSCCCSCCCTTCC
T ss_pred             ceEEEEEECCCCCCHHHHHHH------HHhCccCCCCCCCcc
Confidence            358999999999999999997      666667777777776

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...

Probab=98.78  E-value=4.6e-09  Score=61.10  Aligned_cols=38  Identities=42%  Similarity=0.473  Sum_probs=31.5

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+||+++|+.+||||||+.+      +..+.+...+.||++
T Consensus        22 ~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   59 (201)
T 2gco_A           22 AAIRKKLVIVGDGACGKTCLLIV------FSKDQFPEVYVPTVF   59 (201)
T ss_dssp             CCEEEEEEEEESTTSSHHHHHHH------HHHSSCCSSCCCSSC
T ss_pred             cccceEEEEECCCCCCHHHHHHH------HHhCcCCcccCCccc
Confidence            35679999999999999999997      776667777777766

>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A*

Probab=98.78  E-value=9.6e-09  Score=58.39  Aligned_cols=40  Identities=35%  Similarity=0.470  Sum_probs=31.7

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..+|++++|+.|+|||||+.+      +..+.+...+.+|.+  +.+.
T Consensus         3 ~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~--~~~~   42 (189)
T 4dsu_A            3 TEYKLVVVGADGVGKSALTIQ------LIQNHFVDEYDPTIE--DSYR   42 (189)
T ss_dssp             EEEEEEEECCTTSSHHHHHHH------HHHSSCCCCCCTTCC--EEEE
T ss_pred             cEEEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCCch--heEE
Confidence            568999999999999999997      666667777777765  4444

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A

Probab=98.78  E-value=5.6e-09  Score=58.40  Aligned_cols=36  Identities=22%  Similarity=0.455  Sum_probs=25.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|++++|||||+.+      +..+.+...+.|+++
T Consensus         2 ~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~~~   37 (170)
T 1g16_A            2 SIMKILLIGDSGVGKSCLLVR------FVEDKFNPSFITTIG   37 (170)
T ss_dssp             CEEEEEEEESTTSSHHHHHHH------HHHCCCCC-------
T ss_pred             CceEEEEECcCCCCHHHHHHH------HHhCCCCCCCCCccc
Confidence            458999999999999999997      666667677777776

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C

Probab=98.77  E-value=1.4e-09  Score=61.65  Aligned_cols=37  Identities=46%  Similarity=0.719  Sum_probs=24.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++++|||||+.+      +..+.+...+.||++
T Consensus         6 ~~~~ki~v~G~~~~GKssl~~~------~~~~~~~~~~~~t~~   42 (182)
T 3bwd_D            6 SRFIKCVTVGDGAVGKTCLLIS------YTSNTFPTDYVPTVF   42 (182)
T ss_dssp             -CCCEEEEECSTTSSHHHHHHH------HHHSCCC--------
T ss_pred             CceEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCeee
Confidence            3458999999999999999997      777777777888887

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C

Probab=98.77  E-value=1.8e-09  Score=62.31  Aligned_cols=41  Identities=27%  Similarity=0.331  Sum_probs=7.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccc--cccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLS--QLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~--~~~~~~~~ti~~vd~~   57 (65)
                      ...+||+++|+++||||||+.+      +..+  .+...+.||++ ++++
T Consensus        18 ~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~~t~~-~~~~   60 (208)
T 2yc2_C           18 TLRCKVAVVGEATVGKSALISM------FTSKGSKFLKDYAMTSG-VEVV   60 (208)
T ss_dssp             EEEEEEEEC-----------------------------------------
T ss_pred             ccceEEEEECCCCCCHHHHHHH------HHhCCCcccCCCCCccc-eEEE
Confidence            4678999999999999999997      7776  77778888887 4444

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*

Probab=98.75  E-value=1.2e-08  Score=58.38  Aligned_cols=37  Identities=30%  Similarity=0.333  Sum_probs=29.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.|||||||+.+      +..+.+...+.+|++
T Consensus        19 ~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   55 (190)
T 3con_A           19 MTEYKLVVVGAGGVGKSALTIQ------LIQNHFVDEYDPTIE   55 (190)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHH------HHHSSCCSCCCTTCC
T ss_pred             cceeEEEEECcCCCCHHHHHHH------HHcCCCccccCCccc
Confidence            4568999999999999999997      666666666666665

>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=98.74  E-value=1e-08  Score=58.87  Aligned_cols=41  Identities=32%  Similarity=0.468  Sum_probs=32.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ...+||+++|++++|||||+.+      +..+.+...+.||++  +.+.
T Consensus         6 ~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~--~~~~   46 (199)
T 2gf0_A            6 SNDYRVVVFGAGGVGKSSLVLR------FVKGTFRDTYIPTIE--DTYR   46 (199)
T ss_dssp             CCCEEEEEEECTTSSHHHHHHH------HHHSCCCCTTSCCCC--EEEE
T ss_pred             CCeeEEEEECCCCCcHHHHHHH------HHcCCCCCcccCccc--ccee
Confidence            3458999999999999999997      776777777777776  4443

>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2

Probab=98.73  E-value=4.9e-09  Score=61.22  Aligned_cols=37  Identities=22%  Similarity=0.134  Sum_probs=28.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|||||||+.+      +..+.|...+.++..
T Consensus         5 ~~~~ki~vvG~~~~GKTsli~~------l~~~~~~~~~~~~~~   41 (214)
T 2fh5_B            5 SSQRAVLFVGLCDSGKTLLFVR------LLTGQYRDTQTSITD   41 (214)
T ss_dssp             ---CEEEEECSTTSSHHHHHHH------HHHSCCCCBCCCCSC
T ss_pred             CCCCEEEEECCCCCCHHHHHHH------HhCCCcccccCCcce
Confidence            4568999999999999999997      776667777766544

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...

Probab=98.72  E-value=1.3e-08  Score=56.42  Aligned_cols=35  Identities=31%  Similarity=0.371  Sum_probs=28.5

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++|+|||||+.+      +..+.+...+.|+++
T Consensus         3 ~~~i~v~G~~~~GKssl~~~------l~~~~~~~~~~~~~~   37 (166)
T 2ce2_X            3 EYKLVVVGAGGVGKSALTIQ------LIQNHFVDECDPTIE   37 (166)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHSSCCSCCCTTCC
T ss_pred             eeEEEEECCCCCCHHHHHHH------HHhCcCccccCCccc
Confidence            47999999999999999997      666666666666665

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=98.72  E-value=1.1e-08  Score=59.76  Aligned_cols=37  Identities=43%  Similarity=0.479  Sum_probs=25.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.+||||||+.+      +..+.+...+.||++
T Consensus        23 ~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   59 (207)
T 2fv8_A           23 MIRKKLVVVGDGACGKTCLLIV------FSKDEFPEVYVPTVF   59 (207)
T ss_dssp             SEEEEEEEEECTTSSHHHHHHH------HHHSSCC-------C
T ss_pred             ccCcEEEEECcCCCCHHHHHHH------HhcCCCCCcCCCccc
Confidence            4568999999999999999997      777777777778876

>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=98.71  E-value=2.3e-08  Score=56.54  Aligned_cols=39  Identities=33%  Similarity=0.377  Sum_probs=29.9

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      .....+|++++|++++|||+|+.+      +..+.+. ..+.||++
T Consensus         6 ~~~~~~~i~v~G~~~~GKssli~~------l~~~~~~~~~~~~t~~   45 (180)
T 2g6b_A            6 FYDVAFKVMLVGDSGVGKTCLLVR------FKDGAFLAGTFISTVG   45 (180)
T ss_dssp             CCSEEEEEEEECSTTSSHHHHHHH------HHHSCCCCCCCCCCCS
T ss_pred             cCCcceEEEEECcCCCCHHHHHHH------HHhCCCCCCCcCCcee
Confidence            456789999999999999999997      6555553 35566665

>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A*

Probab=98.70  E-value=1.2e-08  Score=59.22  Aligned_cols=21  Identities=29%  Similarity=0.551  Sum_probs=19.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+||+++|+++||||||+.+
T Consensus         5 ~~~kv~lvG~~~vGKSsL~~~   25 (192)
T 2cjw_A            5 TYYRVVLIGEQGVGKSTLANI   25 (192)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHH
Confidence            468999999999999999996

>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=98.70  E-value=1.4e-08  Score=59.00  Aligned_cols=39  Identities=21%  Similarity=0.412  Sum_probs=28.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+||+++|+.+||||+|+.+      +....+...+.|+++
T Consensus        16 ~~~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   54 (213)
T 3cph_A           16 SYDSIMKILLIGDSGVGKSCLLVR------FVEDKFNPSFITTIG   54 (213)
T ss_dssp             ----CEEEEEECSTTSSHHHHHHH------HHHCCCCCSSSCCCS
T ss_pred             CCCcceEEEEECCCCCCHHHHHHH------HHhCCCCcccCCccc
Confidence            345579999999999999999997      666666666666665

>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B*

Probab=98.67  E-value=3.9e-09  Score=67.31  Aligned_cols=45  Identities=16%  Similarity=0.019  Sum_probs=31.2

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccc---cccceEEEEeeEE----EEEEecC
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLT---THVPTVWAIDQYR----IYKDTLE   65 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~---~~~~ti~~vd~~~----~~~~i~~   65 (65)
                      |++++|++|||||||+.+      +..+.++.   .+.||+| +++..    .+++|||
T Consensus         1 KIvllGdsgvGKTSLl~~------~~~~~~~~~~~~~~~Tig-~~~~~v~~~v~LqIWD   52 (331)
T 3r7w_B            1 MVLLMGVRRCGKSSICKV------VFHNMQPLDTLYLESTSN-PSLEHFSTLIDLAVME   52 (331)
T ss_dssp             CEEEECSTTSSTTHHHHH------HHSCCCSGGGTTCCCCCS-CCCEEECSSSCEEEEE
T ss_pred             CEEEECCCCCCHHHHHHH------HHcCCCCCccceecCeee-eeeEEEccEEEEEEEE
Confidence            789999999999999985      44333322   3678888 55443    3466765

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}

Probab=98.67  E-value=7.1e-09  Score=60.14  Aligned_cols=39  Identities=23%  Similarity=0.336  Sum_probs=30.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+..+||+++|+.+||||||+.+      +..+.+...+.|+++
T Consensus        29 ~~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~~~~   67 (199)
T 3l0i_B           29 EYDYLFKLLLIGDSGVGKSCLLLR------FADDTYTESYISTIG   67 (199)
T ss_dssp             CCSEEEEEEEECCTTSCCTTTTTS------SBCCCCCCHHHHHHC
T ss_pred             ccCcceEEEEECCCCCCHHHHHHH------HhcCCCCCCcCCccc
Confidence            345679999999999999999997      766666655555544

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}

Probab=98.12  E-value=2.4e-09  Score=62.23  Aligned_cols=41  Identities=44%  Similarity=0.729  Sum_probs=33.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ...+|++++|+.|||||||+.+      +..+.+...+.||++  +.+.
T Consensus        28 ~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~--~~~~   68 (204)
T 3th5_A           28 GQAIKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYS   68 (204)
Confidence            4568999999999999999997      777777777888877  5544

>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens}

Probab=98.65  E-value=2.1e-08  Score=60.87  Aligned_cols=38  Identities=21%  Similarity=0.223  Sum_probs=30.3

Q ss_pred             CCceeeEEEEECCC---------CChHHHHHhHhhhcccccc---ccccccccceE
Q psy15257          8 PHQELVKCVVVGDT---------AVGKTRLICARACNKQVSL---SQLLTTHVPTV   51 (65)
Q Consensus         8 ~~~~~~kvv~lG~~---------gvGKTsl~~~~~~~~~~~~---~~~~~~~~~ti   51 (65)
                      .....+||+++|++         +||||||+.+      +..   +.|...+.||+
T Consensus        15 ~~~~~~ki~lvG~~~~~~~~~~~~vGKSsLi~~------l~~~~~~~~~~~~~~t~   64 (255)
T 3c5h_A           15 YFQGTYNISVVGLSGTEKEKGQCGIGKSCLCNR------FVRPSADEFHLDHTSVL   64 (255)
T ss_dssp             SCCSCEEEEEEESCCCTTTTTTCCCSHHHHHHH------HHCCSTTTCCSCCCCEE
T ss_pred             CCCceeEEEEECCCccccccCCCCcCHHHHHHH------HHhccCCccccccCCcc
Confidence            44567999999999         9999999997      665   55666666665

>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A*

Probab=98.63  E-value=5e-08  Score=54.61  Aligned_cols=20  Identities=35%  Similarity=0.659  Sum_probs=18.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|+++||||||+.+
T Consensus         2 ~~ki~ivG~~~~GKSsli~~   21 (169)
T 3q85_A            2 VFKVMLVGESGVGKSTLAGT   21 (169)
T ss_dssp             EEEEEEECSTTSSHHHHHHH
T ss_pred             cEEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}

Probab=98.62  E-value=3.7e-08  Score=55.33  Aligned_cols=21  Identities=43%  Similarity=0.668  Sum_probs=19.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+++||||||+.+
T Consensus         3 ~~~ki~i~G~~~vGKSsl~~~   23 (175)
T 2nzj_A            3 ALYRVVLLGDPGVGKTSLASL   23 (175)
T ss_dssp             CEEEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEEEECCCCccHHHHHHH
Confidence            468999999999999999996

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*

Probab=98.60  E-value=1.1e-08  Score=58.69  Aligned_cols=36  Identities=22%  Similarity=0.342  Sum_probs=27.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|||||||+.+      +..+.+ ..+.||++
T Consensus        14 ~~~~ki~ivG~~~vGKSsL~~~------l~~~~~-~~~~~t~g   49 (181)
T 1fzq_A           14 DQEVRILLLGLDNAGKTTLLKQ------LASEDI-SHITPTQG   49 (181)
T ss_dssp             SSCEEEEEEESTTSSHHHHHHH------HCCSCC-EEEEEETT
T ss_pred             CCceEEEEECCCCCCHHHHHHH------HhcCCC-CcccCcCC
Confidence            4568999999999999999996      555433 34566665

>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A*

Probab=98.60  E-value=4.3e-08  Score=55.90  Aligned_cols=36  Identities=19%  Similarity=0.290  Sum_probs=28.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|+.+||||||+.+      +..+. ...+.||++
T Consensus        16 ~~~~~i~v~G~~~~GKssl~~~------l~~~~-~~~~~~t~~   51 (186)
T 1ksh_A           16 ERELRLLMLGLDNAGKTTILKK------FNGED-VDTISPTLG   51 (186)
T ss_dssp             -CCEEEEEECSTTSSHHHHHHH------HTTCC-CSSCCCCSS
T ss_pred             CCeeEEEEECCCCCCHHHHHHH------HhcCC-CCcccccCc
Confidence            4568999999999999999997      66555 556677765

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=98.60  E-value=6.9e-09  Score=60.74  Aligned_cols=38  Identities=16%  Similarity=0.236  Sum_probs=28.3

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccc---cccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT---THVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~---~~~~ti~   52 (65)
                      ....+|++++|++|+|||+|+.+      +....+..   .+.|+++
T Consensus         9 ~~~~~~i~~~G~~g~GKTsl~~~------l~~~~~~~~~~~~~~~~~   49 (218)
T 1nrj_B            9 KSYQPSIIIAGPQNSGKTSLLTL------LTTDSVRPTVVSQEPLSA   49 (218)
T ss_dssp             -CCCCEEEEECSTTSSHHHHHHH------HHHSSCCCBCCCSSCEEE
T ss_pred             cCCCCEEEEECCCCCCHHHHHHH------HhcCCCCCeeeecCceEE
Confidence            45568999999999999999996      55444433   4667765

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...

Probab=98.60  E-value=1.2e-08  Score=56.98  Aligned_cols=33  Identities=30%  Similarity=0.596  Sum_probs=25.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+++||||||+.+      +..+.|.. +.||++
T Consensus         1 ~ki~~~G~~~~GKssl~~~------l~~~~~~~-~~~t~~   33 (164)
T 1r8s_A            1 MRILMVGLDAAGKTTILYK------LKLGEIVT-TIPTIG   33 (164)
T ss_dssp             CEEEEECSTTSSHHHHHHH------HHHHCSSC-CCCCSS
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCcCc-ccCcCc
Confidence            5899999999999999997      55555543 456654

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*

Probab=98.58  E-value=1.4e-08  Score=57.99  Aligned_cols=38  Identities=24%  Similarity=0.388  Sum_probs=26.2

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .....+|++++|+.+||||||+.+      +..+.+ ..+.||++
T Consensus        17 ~~~~~~~i~v~G~~~~GKSsli~~------l~~~~~-~~~~~t~~   54 (181)
T 2h17_A           17 RGSQEHKVIIVGLDNAGKTTILYQ------FSMNEV-VHTSPTIG   54 (181)
T ss_dssp             ----CEEEEEEEETTSSHHHHHHH------HHTTSC-EEEECCSS
T ss_pred             CCCceeEEEEECCCCCCHHHHHHH------HhcCCC-CccCCcCc
Confidence            345679999999999999999996      555544 34455554

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}

Probab=98.57  E-value=5.6e-08  Score=55.77  Aligned_cols=38  Identities=24%  Similarity=0.273  Sum_probs=29.1

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhcccccccc-ccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQ-LLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~-~~~~~~~ti~   52 (65)
                      ....+||+++|+.+||||||+.+      +..+. +...+.||++
T Consensus        18 ~~~~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~t~~   56 (190)
T 2h57_A           18 GSKEVHVLCLGLDNSGKTTIINK------LKPSNAQSQNILPTIG   56 (190)
T ss_dssp             ---CEEEEEEECTTSSHHHHHHH------TSCGGGCCSSCCCCSS
T ss_pred             CCCccEEEEECCCCCCHHHHHHH------HhcCCCCCCCcCCccc
Confidence            34579999999999999999997      66665 5666777775

>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=98.57  E-value=1.9e-08  Score=57.60  Aligned_cols=36  Identities=25%  Similarity=0.456  Sum_probs=27.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.+||||||+.+      +..+.+. .+.||++
T Consensus        14 ~~~~~i~v~G~~~~GKssl~~~------l~~~~~~-~~~~t~~   49 (187)
T 1zj6_A           14 HQEHKVIIVGLDNAGKTTILYQ------FSMNEVV-HTSPTIG   49 (187)
T ss_dssp             TSCEEEEEEESTTSSHHHHHHH------HHTTSCE-EEECCSC
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HhcCCCC-cCcCCCc
Confidence            3468999999999999999997      5555554 4556654

>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi}

Probab=98.56  E-value=4.9e-08  Score=57.05  Aligned_cols=38  Identities=29%  Similarity=0.253  Sum_probs=29.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+||+++|+.+||||||+.+      +..+.+...+.+|++
T Consensus         8 ~~~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   45 (218)
T 4djt_A            8 RELTYKICLIGDGGVGKTTYINR------VLDGRFEKNYNATVG   45 (218)
T ss_dssp             --CEEEEEEECCTTSSHHHHHCB------CTTCSTTCEEETTTT
T ss_pred             ccCccEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            34579999999999999999997      776666666666665

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}

Probab=98.55  E-value=8.7e-08  Score=54.60  Aligned_cols=21  Identities=24%  Similarity=0.487  Sum_probs=19.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++|||||||+.+
T Consensus         6 ~~~~i~lvG~~gvGKStL~~~   26 (188)
T 2wjg_A            6 KSYEIALIGNPNVGKSTIFNA   26 (188)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            468999999999999999996

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*

Probab=98.55  E-value=7.7e-08  Score=59.12  Aligned_cols=42  Identities=48%  Similarity=0.759  Sum_probs=34.4

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      ..+|++++|+.++|||||+.+      +..+.+...+.||++  +.+...
T Consensus       154 ~~~~i~i~G~~~~GKssli~~------~~~~~~~~~~~~t~~--~~~~~~  195 (332)
T 2wkq_A          154 ELIKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYSAN  195 (332)
T ss_dssp             TCEEEEEEESTTSSHHHHHHH------HHHSCCCCSCCCCSE--EEEEEE
T ss_pred             ceeEEEEECCCCCChHHHHHH------HHhCCCCcccCCccc--ceeEEE
Confidence            358999999999999999997      777778778888887  555543

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*

Probab=98.53  E-value=8e-08  Score=54.27  Aligned_cols=20  Identities=25%  Similarity=0.491  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|++|||||||+.+
T Consensus         3 ~~~v~lvG~~gvGKStL~~~   22 (165)
T 2wji_A            3 SYEIALIGNPNVGKSTIFNA   22 (165)
T ss_dssp             EEEEEEECSTTSSHHHHHHH
T ss_pred             ccEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*

Probab=98.51  E-value=3.1e-08  Score=57.34  Aligned_cols=36  Identities=28%  Similarity=0.557  Sum_probs=27.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.+||||||+.+      +..+.+.. +.||++
T Consensus        27 ~~~~ki~v~G~~~vGKSsLi~~------l~~~~~~~-~~~t~~   62 (192)
T 2b6h_A           27 KKQMRILMVGLDAAGKTTILYK------LKLGEIVT-TIPTIG   62 (192)
T ss_dssp             TSCEEEEEEESTTSSHHHHHHH------HCSSCCEE-EEEETT
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HHhCCccc-cCCcCc
Confidence            4568999999999999999997      66555543 456654

>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A*

Probab=98.49  E-value=1.7e-07  Score=58.42  Aligned_cols=36  Identities=14%  Similarity=0.084  Sum_probs=27.1

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccc--ccc-ccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLS--QLL-TTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~--~~~-~~~~~ti~   52 (65)
                      ..+|++++|+++||||||+.+      +..+  .+. ..+.+|++
T Consensus         2 ~~~KI~lvG~~~vGKSSLi~~------l~~~~~~~~~~~~~~Ti~   40 (307)
T 3r7w_A            2 LGSKLLLMGRSGSGKSSMRSI------IFSNYSAFDTRRLGATID   40 (307)
T ss_dssp             CEEEEEEECCTTSSHHHHHHH------HHSCCCTGGGGGCCCCCS
T ss_pred             CceEEEEECCCCCCHHHHHHH------HHhCCCCccccCcCCccc
Confidence            358999999999999999996      4443  333 35667776

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*

Probab=98.48  E-value=1.3e-07  Score=52.67  Aligned_cols=20  Identities=30%  Similarity=0.509  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|++|||||||+.+
T Consensus         2 ~~ki~~vG~~~~GKSsli~~   21 (166)
T 3q72_A            2 VYKVLLLGAPGVGKSALARI   21 (166)
T ss_dssp             CCEEEEEESTTSSHHHHHHH
T ss_pred             eEEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}

Probab=98.47  E-value=2e-08  Score=57.63  Aligned_cols=22  Identities=23%  Similarity=0.323  Sum_probs=20.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|++|+|||||+.+
T Consensus        46 ~~~~~i~vvG~~g~GKSsll~~   67 (193)
T 2ged_A           46 SYQPSIIIAGPQNSGKTSLLTL   67 (193)
T ss_dssp             CCCCEEEEECCTTSSHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999996

>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum}

Probab=98.47  E-value=1.1e-07  Score=62.92  Aligned_cols=42  Identities=21%  Similarity=0.241  Sum_probs=25.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ....+||+++|+++||||||+.+      +....|...+.||++ ++.+
T Consensus        38 ~~~~~kV~lvG~~~vGKSSLl~~------l~~~~~~~~~~~t~g-~~~~   79 (535)
T 3dpu_A           38 HLQEIKVHLIGDGMAGKTSLLKQ------LIGETFDPKESQTHG-LNVV   79 (535)
T ss_dssp             CCCEEEEEEESSSCSSHHHHHHH------HHC-----------C-CCEE
T ss_pred             cccceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc-eEEE
Confidence            45679999999999999999997      777778888889998 4444

>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*

Probab=98.46  E-value=2e-07  Score=52.10  Aligned_cols=36  Identities=19%  Similarity=0.476  Sum_probs=27.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++++|||||+.+      +..+.+. .+.||++
T Consensus         5 ~~~~~i~v~G~~~~GKssl~~~------l~~~~~~-~~~~t~~   40 (171)
T 1upt_A            5 TREMRILILGLDGAGKTTILYR------LQVGEVV-TTIPTIG   40 (171)
T ss_dssp             SSCEEEEEECSTTSSHHHHHHH------HHHSSCC-CCCCCSS
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HhcCCCC-CcCCcCc
Confidence            3458999999999999999997      5555553 3556655

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*

Probab=98.46  E-value=5.3e-08  Score=56.69  Aligned_cols=36  Identities=33%  Similarity=0.412  Sum_probs=24.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|||||||+.+      +..+.+. .+.||++
T Consensus        23 ~~~~ki~lvG~~~vGKSsLi~~------l~~~~~~-~~~~t~~   58 (198)
T 1f6b_A           23 KKTGKLVFLGLDNAGKTTLLHM------LKDDRLG-QHVPTLH   58 (198)
T ss_dssp             TCCEEEEEEEETTSSHHHHHHH------HSCC-------CCCC
T ss_pred             CCCcEEEEECCCCCCHHHHHHH------HhcCCCC-ccCCCCC
Confidence            3457999999999999999997      6555543 3556654

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}

Probab=98.45  E-value=7e-08  Score=55.23  Aligned_cols=36  Identities=28%  Similarity=0.508  Sum_probs=27.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|+++||||||+.+      +..+.+.. +.||++
T Consensus        20 ~~~~~i~v~G~~~~GKssli~~------l~~~~~~~-~~~t~~   55 (189)
T 2x77_A           20 DRKIRVLMLGLDNAGKTSILYR------LHLGDVVT-TVPTVG   55 (189)
T ss_dssp             TSCEEEEEEEETTSSHHHHHHH------TCCSCCEE-ECSSTT
T ss_pred             CCceEEEEECCCCCCHHHHHHH------HHcCCCCC-cCCCCc
Confidence            3568999999999999999997      65555543 455543

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*

Probab=98.45  E-value=1.2e-07  Score=53.39  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=19.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+||+++|++|||||||+.+
T Consensus         6 ~~~~~i~v~G~~~~GKssl~~~   27 (178)
T 2lkc_A            6 ERPPVVTIMGHVDHGKTTLLDA   27 (178)
T ss_dssp             CCCCEEEEESCTTTTHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999996

>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=98.42  E-value=4.4e-08  Score=55.54  Aligned_cols=36  Identities=19%  Similarity=0.440  Sum_probs=27.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|+.|||||||+.+      +..+.+ ..+.||++
T Consensus        16 ~~~~~i~v~G~~~~GKssli~~------l~~~~~-~~~~~t~~   51 (183)
T 1moz_A           16 NKELRILILGLDGAGKTTILYR------LQIGEV-VTTKPTIG   51 (183)
T ss_dssp             SSCEEEEEEEETTSSHHHHHHH------TCCSEE-EEECSSTT
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HhcCCc-CccCCcCc
Confidence            4568999999999999999997      665555 44555554

>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8

Probab=98.38  E-value=1.1e-07  Score=54.02  Aligned_cols=32  Identities=22%  Similarity=0.368  Sum_probs=24.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccce
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPT   50 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~t   50 (65)
                      +|++++|++|||||||+.+      +..+.+...+.|+
T Consensus         2 ~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~   33 (190)
T 2cxx_A            2 ATIIFAGRSNVGKSTLIYR------LTGKKVRRGKRPG   33 (190)
T ss_dssp             CEEEEEEBTTSSHHHHHHH------HHSCCCSSSSSTT
T ss_pred             cEEEEECCCCCCHHHHHHH------HhCcCCccCCCCC
Confidence            6899999999999999996      5555555544443

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*

Probab=98.36  E-value=3e-07  Score=53.08  Aligned_cols=36  Identities=28%  Similarity=0.288  Sum_probs=25.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|||||||+.+      +..+.+. .+.||++
T Consensus        21 ~~~~ki~~vG~~~vGKSsli~~------l~~~~~~-~~~~t~~   56 (190)
T 1m2o_B           21 NKHGKLLFLGLDNAGKTTLLHM------LKNDRLA-TLQPTWH   56 (190)
T ss_dssp             ---CEEEEEESTTSSHHHHHHH------HHHSCCC-CCCCCCS
T ss_pred             CCccEEEEECCCCCCHHHHHHH------HhcCCCC-ccccCCC
Confidence            3457999999999999999996      5555443 3556655

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*

Probab=98.35  E-value=1.3e-07  Score=54.16  Aligned_cols=37  Identities=19%  Similarity=0.208  Sum_probs=22.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|+|||||+.+      +....|...+.++.+
T Consensus        21 ~~~~~i~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   57 (195)
T 1svi_A           21 GGLPEIALAGRSNVGKSSFINS------LINRKNLARTSSKPG   57 (195)
T ss_dssp             SCCCEEEEEEBTTSSHHHHHHH------HHTC-----------
T ss_pred             CCCCEEEEECCCCCCHHHHHHH------HhCCCCccccCCCCC
Confidence            4568999999999999999997      555554444444443

>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A*

Probab=98.35  E-value=3.9e-07  Score=55.73  Aligned_cols=23  Identities=30%  Similarity=0.417  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHh
Q psy15257         10 QELVKCVVVGDTAVGKTRLICAR   32 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~   32 (65)
                      ...++|+++|++|+|||||+.+.
T Consensus         6 g~~~~I~vvG~~g~GKSTLin~L   28 (274)
T 3t5d_A            6 GFEFTLMVVGESGLGKSTLINSL   28 (274)
T ss_dssp             -CEEEEEEEECTTSSHHHHHHHH
T ss_pred             ccEEEEEEECCCCCCHHHHHHHH
Confidence            45699999999999999999863

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*

Probab=98.33  E-value=2.6e-07  Score=54.32  Aligned_cols=36  Identities=19%  Similarity=0.116  Sum_probs=29.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|++|||||||+.+      +....+...+.++++
T Consensus        37 ~~~~i~ivG~~gvGKTtl~~~------l~~~~~~~~~~~~i~   72 (226)
T 2hf9_A           37 GVVAFDFMGAIGSGKTLLIEK------LIDNLKDKYKIACIA   72 (226)
T ss_dssp             TCEEEEEEESTTSSHHHHHHH------HHHHHTTTCCEEEEE
T ss_pred             CCeEEEEEcCCCCCHHHHHHH------HHHHhccCCeEEEEE
Confidence            358999999999999999997      666666666677776

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}

Probab=98.33  E-value=3.1e-07  Score=57.76  Aligned_cols=35  Identities=31%  Similarity=0.524  Sum_probs=27.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+||+++|+.+||||+|+.+      +..+.|...+ ||++
T Consensus       164 ~~~kI~ivG~~~vGKSsLl~~------l~~~~~~~~~-pT~~  198 (329)
T 3o47_A          164 KEMRILMVGLDAAGKTTILYK------LKLGEIVTTI-PTIG  198 (329)
T ss_dssp             CSEEEEEEESTTSSHHHHHHH------TCSSCCEEEE-EETT
T ss_pred             CcceEEEECCCCccHHHHHHH------HhCCCCCCcc-cccc
Confidence            457999999999999999997      6666665443 5665

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*

Probab=98.32  E-value=2.8e-07  Score=53.28  Aligned_cols=25  Identities=12%  Similarity=0.108  Sum_probs=18.7

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhH
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ......+|++++|+++||||||+.+
T Consensus        15 ~~~~~~~ki~~vG~~~vGKTsLi~~   39 (196)
T 3llu_A           15 YFQGSKPRILLMGLRRSGKSSIQKV   39 (196)
T ss_dssp             -----CCEEEEEESTTSSHHHHHHH
T ss_pred             cccCcceEEEEECCCCCCHHHHHHH
Confidence            3456679999999999999999973

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}

Probab=98.28  E-value=1.1e-06  Score=51.98  Aligned_cols=22  Identities=18%  Similarity=0.332  Sum_probs=19.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+||+++|++|||||||+.+
T Consensus        27 ~~~~kI~vvG~~~vGKSsLin~   48 (228)
T 2qu8_A           27 PHKKTIILSGAPNVGKSSFMNI   48 (228)
T ss_dssp             TTSEEEEEECSTTSSHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHH
Confidence            3468999999999999999996

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A

Probab=98.26  E-value=6.1e-07  Score=51.03  Aligned_cols=24  Identities=33%  Similarity=0.450  Sum_probs=20.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +....+|++++|++|+|||||+.+
T Consensus        19 ~~~~~~~i~v~G~~~~GKSsli~~   42 (195)
T 3pqc_A           19 PPPLKGEVAFVGRSNVGKSSLLNA   42 (195)
T ss_dssp             CCCTTCEEEEEEBTTSSHHHHHHH
T ss_pred             CCCCCeEEEEECCCCCCHHHHHHH
Confidence            334568999999999999999996

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}

Probab=98.23  E-value=1.7e-06  Score=47.80  Aligned_cols=19  Identities=42%  Similarity=0.602  Sum_probs=17.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++++|+.|+|||||+.+
T Consensus         2 ~ki~v~G~~~~GKSsli~~   20 (161)
T 2dyk_A            2 HKVVIVGRPNVGKSSLFNR   20 (161)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            6899999999999999996

>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A

Probab=98.22  E-value=2e-06  Score=52.45  Aligned_cols=22  Identities=41%  Similarity=0.523  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|+++||||||+.+
T Consensus         3 ~~~~kI~lvG~~nvGKTsL~n~   24 (258)
T 3a1s_A            3 LHMVKVALAGCPNVGKTSLFNA   24 (258)
T ss_dssp             CEEEEEEEECCTTSSHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHH
Confidence            3568999999999999999996

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}

Probab=98.19  E-value=2e-06  Score=51.31  Aligned_cols=23  Identities=26%  Similarity=0.382  Sum_probs=19.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+||+++|++|+|||||+.+
T Consensus        26 ~~~~~~i~lvG~~g~GKStlin~   48 (239)
T 3lxx_A           26 RNSQLRIVLVGKTGAGKSATGNS   48 (239)
T ss_dssp             --CEEEEEEECCTTSSHHHHHHH
T ss_pred             CCCceEEEEECCCCCCHHHHHHH
Confidence            34568999999999999999996

>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A*

Probab=98.19  E-value=9e-07  Score=54.60  Aligned_cols=20  Identities=25%  Similarity=0.494  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|+++||||||+.+
T Consensus         3 ~~kI~lvG~~nvGKSTL~n~   22 (272)
T 3b1v_A            3 MTEIALIGNPNSGKTSLFNL   22 (272)
T ss_dssp             CEEEEEECCTTSSHHHHHHH
T ss_pred             ceEEEEECCCCCCHHHHHHH
Confidence            57999999999999999996

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8

Probab=98.18  E-value=9.1e-07  Score=51.26  Aligned_cols=36  Identities=14%  Similarity=0.171  Sum_probs=20.9

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+++++|++|+|||||+.+      +....+...+.|+.|
T Consensus        25 ~~~~v~lvG~~g~GKSTLl~~------l~g~~~~~~~~~~~G   60 (210)
T 1pui_A           25 TGIEVAFAGRSNAGKSSALNT------LTNQKSLARTSKTPG   60 (210)
T ss_dssp             CSEEEEEEECTTSSHHHHHTT------TCCC-----------
T ss_pred             CCcEEEEECCCCCCHHHHHHH------HhCCCccccccCCCc
Confidence            457899999999999999986      554443333445544

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A

Probab=98.18  E-value=1.6e-06  Score=49.34  Aligned_cols=21  Identities=33%  Similarity=0.510  Sum_probs=18.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|++++|++|||||||+.+
T Consensus         3 ~~~ki~ivG~~g~GKStLl~~   23 (172)
T 2gj8_A            3 HGMKVVIAGRPNAGKSSLLNA   23 (172)
T ss_dssp             -CEEEEEEESTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            347999999999999999996

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=98.11  E-value=5.7e-06  Score=52.72  Aligned_cols=22  Identities=32%  Similarity=0.469  Sum_probs=19.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|++|+|||||+.+
T Consensus        35 ~~~~~I~vvG~~g~GKSTLln~   56 (361)
T 2qag_A           35 GFEFTLMVVGESGLGKSTLINS   56 (361)
T ss_dssp             CCEECEEECCCTTSCHHHHHHH
T ss_pred             CCCEEEEEEcCCCCCHHHHHHH
Confidence            3468999999999999999986

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A

Probab=98.07  E-value=2.5e-06  Score=51.36  Aligned_cols=22  Identities=23%  Similarity=0.380  Sum_probs=19.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|+++|++|+|||||+.+
T Consensus        20 ~~~~~I~lvG~~g~GKStl~n~   41 (260)
T 2xtp_A           20 RSELRIILVGKTGTGKSAAGNS   41 (260)
T ss_dssp             -CCEEEEEEECTTSCHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHH
Confidence            3568999999999999999996

>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus}

Probab=98.04  E-value=2.8e-06  Score=51.73  Aligned_cols=20  Identities=40%  Similarity=0.604  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|++|+|||||+.+
T Consensus         3 ~~~i~lvG~~g~GKTTL~n~   22 (271)
T 3k53_A            3 LKTVALVGNPNVGKTTIFNA   22 (271)
T ss_dssp             CEEEEEEECSSSSHHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A*

Probab=97.95  E-value=7e-06  Score=50.33  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++++|++++|||||+.+
T Consensus         3 ~~~I~lvG~~n~GKSTLin~   22 (274)
T 3i8s_A            3 KLTIGLIGNPNSGKTTLFNQ   22 (274)
T ss_dssp             CEEEEEEECTTSSHHHHHHH
T ss_pred             ccEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*

Probab=97.92  E-value=1.8e-05  Score=48.17  Aligned_cols=21  Identities=24%  Similarity=0.453  Sum_probs=19.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++|+++|++|+|||||+.+
T Consensus        38 ~~~~I~vvG~~g~GKSSLin~   58 (270)
T 1h65_A           38 NSLTILVMGKGGVGKSSTVNS   58 (270)
T ss_dssp             CEEEEEEEESTTSSHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            468999999999999999986

>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila}

Probab=97.88  E-value=1.2e-05  Score=48.97  Aligned_cols=19  Identities=32%  Similarity=0.599  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+++||||||+.+
T Consensus         2 ~kI~lvG~~n~GKSTL~n~   20 (256)
T 3iby_A            2 THALLIGNPNCGKTTLFNA   20 (256)
T ss_dssp             CEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4899999999999999996

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*

Probab=97.87  E-value=1.8e-05  Score=47.99  Aligned_cols=21  Identities=24%  Similarity=0.471  Sum_probs=19.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++|+++|++|+|||||+.+
T Consensus        35 ~~~~I~lvG~~g~GKSSLin~   55 (262)
T 3def_A           35 NSMTVLVLGKGGVGKSSTVNS   55 (262)
T ss_dssp             CEEEEEEEECTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            468999999999999999996

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}

Probab=97.79  E-value=4e-06  Score=48.89  Aligned_cols=22  Identities=18%  Similarity=0.228  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+||+++|++|+|||||+.+
T Consensus        27 ~~~~~i~v~G~~~~GKSslin~   48 (223)
T 4dhe_A           27 TVQPEIAFAGRSNAGKSTAINV   48 (223)
T ss_dssp             CCSCEEEEEESCHHHHHHHHHH
T ss_pred             CCCCEEEEEcCCCCCHHHHHHH
Confidence            4568999999999999999996

>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana}

Probab=97.66  E-value=3e-05  Score=50.61  Aligned_cols=24  Identities=29%  Similarity=0.259  Sum_probs=20.2

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +....+|++++|+.++|||||+.+
T Consensus        30 ~~~~~~kI~IvG~~~vGKSTLin~   53 (423)
T 3qq5_A           30 DAGFRRYIVVAGRRNVGKSSFMNA   53 (423)
T ss_dssp             --CCCEEEEEECSCSTTTTTTTTS
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHH
Confidence            345678999999999999999996

>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A*

Probab=97.63  E-value=3.8e-05  Score=46.69  Aligned_cols=22  Identities=27%  Similarity=0.469  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+|+++|++++|||||+.+
T Consensus        24 ~~~~~i~vvG~~~~GKSSLln~   45 (299)
T 2aka_B           24 LDLPQIAVVGGQSAGKSSVLEN   45 (299)
T ss_dssp             CCCCEEEEEEBTTSCHHHHHHH
T ss_pred             CCCCeEEEEeCCCCCHHHHHHH
Confidence            4567999999999999999996

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*

Probab=97.61  E-value=2.2e-05  Score=48.85  Aligned_cols=22  Identities=32%  Similarity=0.469  Sum_probs=18.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|++|+|||||+.+
T Consensus        16 ~~~~~I~lvG~nG~GKSTLl~~   37 (301)
T 2qnr_A           16 GFEFTLMVVGESGLGKSTLINS   37 (301)
T ss_dssp             --CEEEEEEEETTSSHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999985

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}

Probab=97.61  E-value=4.8e-05  Score=49.27  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+++||||||+.+
T Consensus       174 ~~~ki~lvG~~nvGKSSLin~  194 (436)
T 2hjg_A          174 EVIQFCLIGRPNVGKSSLVNA  194 (436)
T ss_dssp             TCEEEEEECSTTSSHHHHHHH
T ss_pred             cCcEEEEEcCCCCCHHHHHHH
Confidence            458999999999999999996

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X

Probab=97.61  E-value=0.00017  Score=44.75  Aligned_cols=21  Identities=29%  Similarity=0.317  Sum_probs=18.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|++|+|||||+.+
T Consensus         7 r~~~VaIvG~~nvGKSTLln~   27 (301)
T 1ega_A            7 YCGFIAIVGRPNVGKSTLLNK   27 (301)
T ss_dssp             EEEEEEEECSSSSSHHHHHHH
T ss_pred             cCCEEEEECCCCCCHHHHHHH
Confidence            456899999999999999996

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}

Probab=97.58  E-value=8.1e-05  Score=47.03  Aligned_cols=21  Identities=38%  Similarity=0.620  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|++|||||||+.+
T Consensus       166 ~~~~v~lvG~~gvGKSTLin~  186 (357)
T 2e87_A          166 EIPTVVIAGHPNVGKSTLLKA  186 (357)
T ss_dssp             SSCEEEEECSTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            457999999999999999996

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=97.57  E-value=7.2e-05  Score=48.48  Aligned_cols=21  Identities=38%  Similarity=0.645  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++|||||||+.+
T Consensus       179 ~~~kvaivG~~gvGKSTLln~  199 (439)
T 1mky_A          179 DAIKVAIVGRPNVGKSTLFNA  199 (439)
T ss_dssp             SCEEEEEECSTTSSHHHHHHH
T ss_pred             cCceEEEECCCCCCHHHHHHH
Confidence            458999999999999999986

>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1

Probab=97.57  E-value=0.00012  Score=45.50  Aligned_cols=22  Identities=27%  Similarity=0.324  Sum_probs=19.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++++|+++||||||+.+
T Consensus         5 ~~~g~V~ivG~~nvGKSTLln~   26 (301)
T 1wf3_A            5 TYSGFVAIVGKPNVGKSTLLNN   26 (301)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHH
T ss_pred             ccCCEEEEECCCCCCHHHHHHH
Confidence            3457899999999999999996

>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2

Probab=97.55  E-value=0.00011  Score=47.49  Aligned_cols=19  Identities=37%  Similarity=0.564  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+.++|.++||||||+.+
T Consensus         1 ~kI~ivG~pnvGKSTL~n~   19 (397)
T 1wxq_A            1 MEIGVVGKPNVGKSTFFSA   19 (397)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4899999999999999985

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=97.54  E-value=5.4e-05  Score=49.38  Aligned_cols=22  Identities=32%  Similarity=0.469  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|++|+|||||+..
T Consensus        29 ~vsf~I~lvG~sGaGKSTLln~   50 (418)
T 2qag_C           29 GFEFTLMVVGESGLGKSTLINS   50 (418)
T ss_dssp             CCCEEEEEECCTTSSHHHHHHH
T ss_pred             CCCEEEEEECCCCCcHHHHHHH
Confidence            4568899999999999999985

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*

Probab=97.52  E-value=0.00015  Score=45.06  Aligned_cols=24  Identities=29%  Similarity=0.476  Sum_probs=20.5

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+...-+|.++|+++||||||+.+
T Consensus         6 ~~~~~g~v~ivG~~nvGKSTLin~   29 (308)
T 3iev_A            6 HHMKVGYVAIVGKPNVGKSTLLNN   29 (308)
T ss_dssp             -CCEEEEEEEECSTTSSHHHHHHH
T ss_pred             CCCCCCEEEEECCCCCcHHHHHHH
Confidence            445678999999999999999996

>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8

Probab=97.51  E-value=5.7e-05  Score=48.04  Aligned_cols=18  Identities=33%  Similarity=0.504  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|.++|.+++|||||+.+
T Consensus       160 ~V~lvG~~nvGKSTLln~  177 (342)
T 1lnz_A          160 DVGLVGFPSVGKSTLLSV  177 (342)
T ss_dssp             CEEEESSTTSSHHHHHHH
T ss_pred             eeeeeCCCCCCHHHHHHH
Confidence            578999999999999996

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A

Probab=97.50  E-value=9.3e-05  Score=47.33  Aligned_cols=19  Identities=37%  Similarity=0.457  Sum_probs=17.1

Q ss_pred             eE-EEEECCCCChHHHHHhH
Q psy15257         13 VK-CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~k-vv~lG~~gvGKTsl~~~   31 (65)
                      ++ ++++|++|+|||||+.+
T Consensus       179 ~~~V~lvG~~naGKSTLln~  198 (364)
T 2qtf_A          179 IPSIGIVGYTNSGKTSLFNS  198 (364)
T ss_dssp             CCEEEEECBTTSSHHHHHHH
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            45 88999999999999986

>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A*

Probab=97.49  E-value=0.0001  Score=48.73  Aligned_cols=21  Identities=33%  Similarity=0.517  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+++||||||+.+
T Consensus       232 ~~~kV~ivG~~nvGKSSLln~  252 (476)
T 3gee_A          232 EGVSTVIAGKPNAGKSTLLNT  252 (476)
T ss_dssp             HCEEEEEECCTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            357899999999999999997

>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A*

Probab=97.47  E-value=0.00028  Score=45.22  Aligned_cols=23  Identities=43%  Similarity=0.406  Sum_probs=20.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+|++++|+.++|||||+.+
T Consensus         5 ~~~~~~I~vvG~~~~GKSTLi~~   27 (403)
T 3sjy_A            5 VQPEVNIGVVGHVDHGKTTLVQA   27 (403)
T ss_dssp             CCCCCEEEEECSTTSSHHHHHHH
T ss_pred             cCCCcEEEEECCCCCCHHHHHHH
Confidence            34568999999999999999986

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1

Probab=97.46  E-value=7.2e-05  Score=42.97  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+|+..
T Consensus         7 ~i~i~GpsGsGKSTL~~~   24 (180)
T 1kgd_A            7 TLVLLGAHGVGRRHIKNT   24 (180)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999985

>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A*

Probab=97.45  E-value=0.00016  Score=46.38  Aligned_cols=23  Identities=39%  Similarity=0.365  Sum_probs=20.5

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++++|..++|||||+.+
T Consensus         7 ~~~~~~I~iiG~~~~GKSTLi~~   29 (410)
T 1kk1_A            7 RQAEVNIGMVGHVDHGKTTLTKA   29 (410)
T ss_dssp             CSEEEEEEEECSTTSSHHHHHHH
T ss_pred             CCCccEEEEECCCCCCHHHHHHH
Confidence            35678999999999999999986

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A

Probab=97.42  E-value=8.3e-05  Score=43.79  Aligned_cols=17  Identities=29%  Similarity=0.530  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |+++||+|+|||+|+.+
T Consensus         4 IVi~GPSG~GK~Tl~~~   20 (186)
T 1ex7_A            4 IVISGPSGTGKSTLLKK   20 (186)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78999999999999985

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=97.40  E-value=0.00015  Score=47.01  Aligned_cols=19  Identities=32%  Similarity=0.560  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+++||||||+.|
T Consensus         2 ~~v~ivG~pnvGKStL~nr   20 (439)
T 1mky_A            2 ATVLIVGRPNVGKSTLFNK   20 (439)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4799999999999999996

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1

Probab=97.39  E-value=8.9e-05  Score=43.33  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+..
T Consensus         5 ~~i~lvGpsGaGKSTLl~~   23 (198)
T 1lvg_A            5 RPVVLSGPSGAGKSTLLKK   23 (198)
T ss_dssp             CCEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3678999999999999974

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}

Probab=97.38  E-value=0.00011  Score=42.77  Aligned_cols=20  Identities=35%  Similarity=0.400  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++++|.+|+|||+|+.+
T Consensus        30 ~~~i~i~G~~g~GKTTl~~~   49 (221)
T 2wsm_A           30 TVAVNIMGAIGSGKTLLIER   49 (221)
T ss_dssp             CEEEEEEECTTSCHHHHHHH
T ss_pred             ceEEEEEcCCCCCHHHHHHH
Confidence            46899999999999999986

>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2

Probab=97.37  E-value=0.00011  Score=47.27  Aligned_cols=19  Identities=47%  Similarity=0.711  Sum_probs=17.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +++.++|.++||||||+.+
T Consensus         3 ~kI~IVG~pnvGKSTL~n~   21 (363)
T 1jal_A            3 FKCGIVGLPNVGKSTLFNA   21 (363)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            6899999999999999995

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11

Probab=97.37  E-value=0.00011  Score=42.67  Aligned_cols=18  Identities=39%  Similarity=0.697  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+..
T Consensus         2 ~i~l~G~nGsGKTTLl~~   19 (178)
T 1ye8_A            2 KIIITGEPGVGKTTLVKK   19 (178)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999974

>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8

Probab=97.36  E-value=0.00018  Score=46.25  Aligned_cols=22  Identities=41%  Similarity=0.373  Sum_probs=19.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|+.++|||||+.+
T Consensus         6 ~~~~~I~iiG~~d~GKSTLi~~   27 (408)
T 1s0u_A            6 QAEVNIGMVGHVDHGKTSLTKA   27 (408)
T ss_dssp             CCCEEEEEESCTTSSHHHHHHH
T ss_pred             CCceEEEEEcCCCCCHHHHHHH
Confidence            3468999999999999999986

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25

Probab=97.36  E-value=0.00011  Score=41.89  Aligned_cols=19  Identities=21%  Similarity=0.280  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+++..
T Consensus        10 ~~i~l~G~~GsGKSTl~~~   28 (191)
T 1zp6_A           10 NILLLSGHPGSGKSTIAEA   28 (191)
T ss_dssp             EEEEEEECTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3588999999999999974

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}

Probab=97.36  E-value=9.7e-05  Score=45.45  Aligned_cols=20  Identities=30%  Similarity=0.542  Sum_probs=18.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++.++|++|+|||+|+..
T Consensus         2 ~f~v~lvG~nGaGKSTLln~   21 (270)
T 3sop_A            2 DFNIMVVGQSGLGKSTLVNT   21 (270)
T ss_dssp             EEEEEEEESSSSSHHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHHH
Confidence            48899999999999999974

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*

Probab=97.32  E-value=0.00012  Score=46.16  Aligned_cols=20  Identities=30%  Similarity=0.471  Sum_probs=18.1

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|+++|++|+|||||+.+
T Consensus        34 lp~I~vvG~~~sGKSSLln~   53 (360)
T 3t34_A           34 LPAIAVVGGQSSGKSSVLES   53 (360)
T ss_dssp             CCEEEEECBTTSSHHHHHHH
T ss_pred             CCEEEEECCCCCcHHHHHHH
Confidence            45899999999999999996

>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A

Probab=97.30  E-value=0.00024  Score=45.65  Aligned_cols=19  Identities=37%  Similarity=0.476  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +++.++|.+++|||||+.+
T Consensus         2 ~~v~IVG~pnvGKSTL~n~   20 (368)
T 2dby_A            2 LAVGIVGLPNVGKSTLFNA   20 (368)
T ss_dssp             CSEEEECCSSSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5789999999999999985

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*

Probab=97.30  E-value=0.0002  Score=46.59  Aligned_cols=22  Identities=32%  Similarity=0.668  Sum_probs=19.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|+++||||||+.+
T Consensus       193 ~~~~ki~ivG~~~vGKSslin~  214 (456)
T 4dcu_A          193 EEVIQFCLIGRPNVGKSSLVNA  214 (456)
T ss_dssp             TTCEEEEEECSTTSSHHHHHHH
T ss_pred             cccceeEEecCCCCCHHHHHHH
Confidence            4568999999999999999996

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*

Probab=97.26  E-value=0.00015  Score=41.37  Aligned_cols=17  Identities=24%  Similarity=0.468  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      -+.++|++|+|||+|+.
T Consensus        11 i~~l~G~nGsGKSTl~~   27 (171)
T 4gp7_A           11 LVVLIGSSGSGKSTFAK   27 (171)
T ss_dssp             EEEEECCTTSCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46789999999999998

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*

Probab=97.23  E-value=0.00017  Score=43.18  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|+..
T Consensus        18 ii~l~GpsGsGKSTLlk~   35 (219)
T 1s96_A           18 LYIVSAPSGAGKSSLIQA   35 (219)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999985

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0

Probab=97.22  E-value=0.00022  Score=42.38  Aligned_cols=19  Identities=26%  Similarity=0.520  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+.+
T Consensus        20 ~~ivl~GPSGaGKsTL~~~   38 (197)
T 3ney_A           20 KTLVLIGASGVGRSHIKNA   38 (197)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECcCCCCHHHHHHH
Confidence            4578899999999999985

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}

Probab=97.22  E-value=0.00018  Score=41.39  Aligned_cols=18  Identities=28%  Similarity=0.438  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+++..
T Consensus         9 ii~l~Gp~GsGKSTl~~~   26 (205)
T 3tr0_A            9 LFIISAPSGAGKTSLVRA   26 (205)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECcCCCCHHHHHHH
Confidence            578899999999999974

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}

Probab=97.21  E-value=0.00019  Score=42.05  Aligned_cols=19  Identities=32%  Similarity=0.377  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|++|+|||+++..
T Consensus         9 ~~i~l~GpsGsGKsTl~~~   27 (208)
T 3tau_A            9 LLIVLSGPSGVGKGTVREA   27 (208)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             cEEEEECcCCCCHHHHHHH
Confidence            3578899999999999985

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A

Probab=97.20  E-value=0.00019  Score=41.98  Aligned_cols=18  Identities=33%  Similarity=0.556  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|++|+|||+|+..
T Consensus        22 i~~l~GpnGsGKSTLl~~   39 (207)
T 1znw_A           22 VVVLSGPSAVGKSTVVRC   39 (207)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*

Probab=97.19  E-value=0.00018  Score=46.80  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=18.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|+++|++|||||||+.+
T Consensus        23 ~~~V~lvG~~nvGKSTL~n~   42 (456)
T 4dcu_A           23 KPVVAIVGRPNVGKSTIFNR   42 (456)
T ss_dssp             CCEEEEECSSSSSHHHHHHH
T ss_pred             CCEEEEECCCCCcHHHHHHH
Confidence            46899999999999999996

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}

Probab=97.16  E-value=0.00022  Score=42.29  Aligned_cols=18  Identities=39%  Similarity=0.538  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        25 ~~~lvGpsGsGKSTLl~~   42 (218)
T 1z6g_A           25 PLVICGPSGVGKGTLIKK   42 (218)
T ss_dssp             CEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}

Probab=97.15  E-value=0.00022  Score=46.19  Aligned_cols=19  Identities=26%  Similarity=0.441  Sum_probs=17.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|+++||||||+.+
T Consensus         4 ~~V~ivG~~nvGKStL~n~   22 (436)
T 2hjg_A            4 PVVAIVGRPNVGKSTIFNR   22 (436)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            6899999999999999996

>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A

Probab=97.15  E-value=0.0003  Score=44.39  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|+++|+.++|||||+.+
T Consensus        30 ~~~~I~vvG~~~~GKSSLln~   50 (353)
T 2x2e_A           30 DLPQIAVVGGQSAGKSSVLEN   50 (353)
T ss_dssp             CCCEEEEECBTTSSHHHHHHT
T ss_pred             CCCeEEEECCCCCCHHHHHHH
Confidence            357999999999999999996

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1

Probab=97.08  E-value=0.00029  Score=45.95  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||||+.+
T Consensus       159 ~VgLVG~~gAGKSTLL~~  176 (416)
T 1udx_A          159 DVGLVGYPNAGKSSLLAA  176 (416)
T ss_dssp             SEEEECCGGGCHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            478999999999999985

>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ...

Probab=97.04  E-value=0.00048  Score=47.24  Aligned_cols=31  Identities=19%  Similarity=0.109  Sum_probs=26.6

Q ss_pred             CCCCCCCCCceeeEEEEECCCCChHHHHHhH
Q psy15257          1 MLSDNEQPHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         1 m~~~~~~~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      |.+..........+++++|+.++|||||+.+
T Consensus         1 M~~~l~~~~~~~~~I~IvG~~~aGKTTL~~~   31 (691)
T 1dar_A            1 MAVKVEYDLKRLRNIGIAAHIDAGKTTTTER   31 (691)
T ss_dssp             CCTTCCCCGGGEEEEEEEECTTSCHHHHHHH
T ss_pred             CCccccCccccccEEEEECCCCCCHHHHHHH
Confidence            6666666667789999999999999999986

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}

Probab=97.04  E-value=0.00037  Score=40.54  Aligned_cols=19  Identities=42%  Similarity=0.483  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++.+
T Consensus        13 ~~i~l~G~sGsGKsTl~~~   31 (204)
T 2qor_A           13 PPLVVCGPSGVGKGTLIKK   31 (204)
T ss_dssp             CCEEEECCTTSCHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4578999999999999985

>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens}

Probab=97.02  E-value=0.00056  Score=44.52  Aligned_cols=22  Identities=27%  Similarity=0.336  Sum_probs=19.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.++|.++||||||+.+
T Consensus        20 ~~~~kvgIVG~pnvGKSTL~n~   41 (396)
T 2ohf_A           20 GTSLKIGIVGLPNVGKSTFFNV   41 (396)
T ss_dssp             SSCCCEEEECCSSSSHHHHHHH
T ss_pred             cCCCEEEEECCCCCCHHHHHHH
Confidence            3457899999999999999985

>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus}

Probab=97.01  E-value=0.00014  Score=48.85  Aligned_cols=20  Identities=25%  Similarity=0.320  Sum_probs=18.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++++|+.++|||||+.+
T Consensus         4 ~pkV~IvG~~~vGKTSLl~~   23 (537)
T 3izy_P            4 SPVVTIMGHVDHGKTTLLDK   23 (537)
T ss_dssp             CCBCEEEESTTTTHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            46899999999999999996

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*

Probab=97.00  E-value=0.00037  Score=41.96  Aligned_cols=18  Identities=17%  Similarity=0.398  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~iiG~nGsGKSTLl~~   50 (235)
T 3tif_A           33 FVSIMGPSGSGKSTMLNI   50 (235)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367999999999999973

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2

Probab=96.99  E-value=0.00043  Score=39.18  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||++...
T Consensus         6 ~i~i~G~~GsGKsTla~~   23 (175)
T 1via_A            6 NIVFIGFMGSGKSTLARA   23 (175)
T ss_dssp             CEEEECCTTSCHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            588999999999999875

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A

Probab=96.98  E-value=0.00042  Score=39.59  Aligned_cols=18  Identities=33%  Similarity=0.399  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~v~L~G~nGaGKTTLlr~   52 (158)
T 1htw_A           35 MVYLNGDLGAGKTTLTRG   52 (158)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            577899999999999974

>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2

Probab=96.98  E-value=0.0014  Score=42.51  Aligned_cols=21  Identities=33%  Similarity=0.425  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|++|+|||+|+..
T Consensus        19 ~g~~vgiVG~pnaGKSTL~n~   39 (392)
T 1ni3_A           19 NNLKTGIVGMPNVGKSTFFRA   39 (392)
T ss_dssp             SCCEEEEEECSSSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            357899999999999999985

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*

Probab=96.97  E-value=0.00034  Score=42.86  Aligned_cols=22  Identities=32%  Similarity=0.508  Sum_probs=19.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+|+++|+.++|||||+.+
T Consensus        22 ~~~~~I~vvG~~~~GKSTlln~   43 (315)
T 1jwy_B           22 LDLPQIVVVGSQSSGKSSVLEN   43 (315)
T ss_dssp             TCCCEEEEEECSSSSHHHHHHH
T ss_pred             CCCCeEEEEcCCCCCHHHHHHH
Confidence            3457899999999999999996

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*

Probab=96.97  E-value=0.00062  Score=38.39  Aligned_cols=19  Identities=21%  Similarity=0.329  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus         9 ~~i~l~G~~GsGKSTl~~~   27 (175)
T 1knq_A            9 HIYVLMGVSGSGKSAVASE   27 (175)
T ss_dssp             EEEEEECSTTSCHHHHHHH
T ss_pred             cEEEEEcCCCCCHHHHHHH
Confidence            4688999999999999974

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20

Probab=96.95  E-value=0.00051  Score=38.29  Aligned_cols=19  Identities=32%  Similarity=0.565  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        44 ~~~ll~G~~G~GKT~l~~~   62 (195)
T 1jbk_A           44 NNPVLIGEPGVGKTAIVEG   62 (195)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             CceEEECCCCCCHHHHHHH
Confidence            3578999999999999975

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25

Probab=96.94  E-value=0.00048  Score=39.39  Aligned_cols=18  Identities=22%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         4 ii~l~G~~GaGKSTl~~~   21 (189)
T 2bdt_A            4 LYIITGPAGVGKSTTCKR   21 (189)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            468899999999999974

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}

Probab=96.93  E-value=0.00048  Score=40.21  Aligned_cols=21  Identities=19%  Similarity=0.192  Sum_probs=17.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.++|++|+|||+|+..
T Consensus        21 ~g~~v~I~G~sGsGKSTl~~~   41 (208)
T 3c8u_A           21 GRQLVALSGAPGSGKSTLSNP   41 (208)
T ss_dssp             SCEEEEEECCTTSCTHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            346788999999999999974

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*

Probab=96.93  E-value=0.0006  Score=38.00  Aligned_cols=18  Identities=11%  Similarity=0.124  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++.+
T Consensus         3 ~i~l~G~~GsGKsT~~~~   20 (173)
T 3kb2_A            3 LIILEGPDCCFKSTVAAK   20 (173)
T ss_dssp             EEEEECSSSSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999985

>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B*

Probab=96.93  E-value=0.00013  Score=48.29  Aligned_cols=20  Identities=35%  Similarity=0.582  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|+++||||||+.+
T Consensus       243 ~~kV~ivG~pnvGKSSLln~  262 (482)
T 1xzp_A          243 GLRMVIVGKPNVGKSTLLNR  262 (482)
T ss_dssp             CEEEEEECCHHHHTCHHHHH
T ss_pred             CCEEEEECcCCCcHHHHHHH
Confidence            37999999999999999986

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*

Probab=96.92  E-value=0.00039  Score=39.54  Aligned_cols=19  Identities=42%  Similarity=0.506  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+|+..
T Consensus        39 ~~~~l~G~~G~GKTtL~~~   57 (180)
T 3ec2_A           39 KGLTFVGSPGVGKTHLAVA   57 (180)
T ss_dssp             CEEEECCSSSSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}

Probab=96.89  E-value=0.00041  Score=45.70  Aligned_cols=21  Identities=38%  Similarity=0.558  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++++|||||+.+
T Consensus       223 ~~~kV~ivG~~nvGKSSLln~  243 (462)
T 3geh_A          223 TGLKVAIVGRPNVGKSSLLNA  243 (462)
T ss_dssp             HCEEEEEEECTTSSHHHHHHH
T ss_pred             CCCEEEEEcCCCCCHHHHHHH
Confidence            357899999999999999996

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2

Probab=96.89  E-value=0.00057  Score=38.35  Aligned_cols=18  Identities=22%  Similarity=0.333  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         6 ~i~l~G~~GsGKSTl~~~   23 (173)
T 1kag_A            6 NIFLVGPMGAGKSTIGRQ   23 (173)
T ss_dssp             CEEEECCTTSCHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999974

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}

Probab=96.89  E-value=0.00068  Score=39.26  Aligned_cols=19  Identities=37%  Similarity=0.385  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||++...
T Consensus        26 ~~i~l~G~~GsGKsTl~~~   44 (199)
T 3vaa_A           26 VRIFLTGYMGAGKTTLGKA   44 (199)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             CEEEEEcCCCCCHHHHHHH
Confidence            4689999999999999975

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12

Probab=96.87  E-value=0.00057  Score=41.80  Aligned_cols=17  Identities=18%  Similarity=0.518  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        35 ~~liG~nGsGKSTLlk~   51 (262)
T 1b0u_A           35 ISIIGSSGSGKSTFLRC   51 (262)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999999973

>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8

Probab=96.86  E-value=0.001  Score=43.03  Aligned_cols=23  Identities=26%  Similarity=0.524  Sum_probs=20.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+|++++|+.++|||||+.+
T Consensus        21 ~~~~~~i~iiG~~~~GKSTLi~~   43 (434)
T 1zun_B           21 RKEMLRFLTCGNVDDGKSTLIGR   43 (434)
T ss_dssp             SCEEEEEEEECCTTSSHHHHHHH
T ss_pred             cCCceEEEEEECCCCCHHHHHHH
Confidence            34568999999999999999986

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}

Probab=96.86  E-value=0.00059  Score=39.19  Aligned_cols=19  Identities=26%  Similarity=0.328  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus         7 ~~i~l~G~~GsGKSTl~~~   25 (207)
T 2j41_A            7 LLIVLSGPSGVGKGTVRKR   25 (207)
T ss_dssp             CEEEEECSTTSCHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3688999999999999974

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}

Probab=96.86  E-value=0.00065  Score=40.95  Aligned_cols=18  Identities=39%  Similarity=0.615  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (237)
T 2cbz_A           33 LVAVVGQVGCGKSSLLSA   50 (237)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12

Probab=96.86  E-value=0.00067  Score=40.93  Aligned_cols=18  Identities=17%  Similarity=0.289  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (243)
T 1mv5_A           30 IIAFAGPSGGGKSTIFSL   47 (243)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A

Probab=96.86  E-value=0.00046  Score=41.25  Aligned_cols=17  Identities=24%  Similarity=0.571  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        33 ~~iiG~nGsGKSTLl~~   49 (224)
T 2pcj_A           33 VSIIGASGSGKSTLLYI   49 (224)
T ss_dssp             EEEEECTTSCHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999999973

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*

Probab=96.85  E-value=0.0007  Score=38.16  Aligned_cols=18  Identities=17%  Similarity=0.447  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|.+|+|||++...
T Consensus         5 ~i~l~G~~GsGKST~a~~   22 (178)
T 1qhx_A            5 MIILNGGSSAGKSGIVRC   22 (178)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            588999999999999975

>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A*

Probab=96.84  E-value=0.00075  Score=45.73  Aligned_cols=21  Identities=29%  Similarity=0.290  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|+.++|||||+.+
T Consensus         4 r~~~V~IvGh~d~GKTTLl~~   24 (594)
T 1g7s_A            4 RSPIVSVLGHVDHGKTTLLDH   24 (594)
T ss_dssp             CCCEEEEECSTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCcHHHHHHH
Confidence            347899999999999999986

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*

Probab=96.84  E-value=0.00069  Score=41.09  Aligned_cols=18  Identities=28%  Similarity=0.339  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~i~G~nGsGKSTLl~~   54 (247)
T 2ff7_A           37 VIGIVGRSGSGKSTLTKL   54 (247)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12

Probab=96.84  E-value=0.00064  Score=41.18  Aligned_cols=18  Identities=33%  Similarity=0.654  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~liG~nGsGKSTLl~~   43 (240)
T 2onk_A           26 YCVLLGPTGAGKSVFLEL   43 (240)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999973

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A

Probab=96.82  E-value=0.00083  Score=37.15  Aligned_cols=18  Identities=17%  Similarity=0.265  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||++...
T Consensus         3 ~I~l~G~~GsGKsT~a~~   20 (179)
T 3lw7_A            3 VILITGMPGSGKSEFAKL   20 (179)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999985

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}

Probab=96.82  E-value=0.00042  Score=40.97  Aligned_cols=18  Identities=22%  Similarity=0.246  Sum_probs=12.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+++..
T Consensus        29 ii~l~Gp~GsGKSTl~~~   46 (231)
T 3lnc_A           29 ILVLSSPSGCGKTTVANK   46 (231)
T ss_dssp             EEEEECSCC----CHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}

Probab=96.81  E-value=0.00067  Score=41.93  Aligned_cols=17  Identities=29%  Similarity=0.569  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        37 ~~iiGpnGsGKSTLl~~   53 (275)
T 3gfo_A           37 TAILGGNGVGKSTLFQN   53 (275)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999999973

>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A*

Probab=96.81  E-value=0.00056  Score=41.88  Aligned_cols=19  Identities=26%  Similarity=0.532  Sum_probs=17.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|.+|||||||+.+
T Consensus       100 ~~v~~vG~~~vGKSslin~  118 (262)
T 3cnl_A          100 ARVLIVGVPNTGKSTIINK  118 (262)
T ss_dssp             CEEEEEESTTSSHHHHHHH
T ss_pred             hheEEeCCCCCCHHHHHHH
Confidence            5899999999999999986

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11

Probab=96.81  E-value=0.00062  Score=39.89  Aligned_cols=18  Identities=39%  Similarity=0.571  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+++..
T Consensus         3 ~i~i~G~nG~GKTTll~~   20 (189)
T 2i3b_A            3 HVFLTGPPGVGKTTLIHK   20 (189)
T ss_dssp             CEEEESCCSSCHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            578899999999999975

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=96.80  E-value=0.00065  Score=44.60  Aligned_cols=20  Identities=30%  Similarity=0.544  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.++|++|+|||+|+..
T Consensus        42 i~~vaLvG~nGaGKSTLln~   61 (427)
T 2qag_B           42 CFNILCVGETGLGKSTLMDT   61 (427)
T ss_dssp             EEEEEEECSTTSSSHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHHH
Confidence            35699999999999999974

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*

Probab=96.80  E-value=0.00068  Score=41.25  Aligned_cols=18  Identities=28%  Similarity=0.540  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~liG~nGsGKSTLlk~   52 (257)
T 1g6h_A           35 VTLIIGPNGSGKSTLINV   52 (257)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A

Probab=96.79  E-value=0.00088  Score=39.97  Aligned_cols=19  Identities=21%  Similarity=0.440  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        28 ~~i~l~G~~GsGKSTl~k~   46 (246)
T 2bbw_A           28 LRAVILGPPGSGKGTVCQR   46 (246)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4689999999999999974

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*

Probab=96.79  E-value=0.00073  Score=39.16  Aligned_cols=19  Identities=37%  Similarity=0.524  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        26 ~~i~l~G~sGsGKSTl~~~   44 (200)
T 3uie_A           26 CVIWVTGLSGSGKSTLACA   44 (200)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5688999999999999874

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}

Probab=96.79  E-value=0.00075  Score=39.12  Aligned_cols=19  Identities=32%  Similarity=0.440  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        30 ~~i~l~G~~GsGKSTl~~~   48 (200)
T 4eun_A           30 RHVVVMGVSGSGKTTIAHG   48 (200)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*

Probab=96.78  E-value=0.00065  Score=42.97  Aligned_cols=20  Identities=30%  Similarity=0.267  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++..
T Consensus       129 g~vi~lvG~nGaGKTTll~~  148 (328)
T 3e70_C          129 PYVIMFVGFNGSGKTTTIAK  148 (328)
T ss_dssp             SEEEEEECCTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            45688999999999999985

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A

Probab=96.78  E-value=0.00086  Score=40.18  Aligned_cols=18  Identities=39%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        36 ~~~i~G~nGsGKSTLl~~   53 (229)
T 2pze_A           36 LLAVAGSTGAGKTSLLMM   53 (229)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*

Probab=96.78  E-value=0.00074  Score=41.45  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        52 i~~liG~NGsGKSTLlk~   69 (263)
T 2olj_A           52 VVVVIGPSGSGKSTFLRC   69 (263)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEEcCCCCcHHHHHHH
Confidence            367899999999999973

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12

Probab=96.77  E-value=0.00074  Score=40.71  Aligned_cols=18  Identities=28%  Similarity=0.488  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~l~G~nGsGKSTLl~~   51 (240)
T 1ji0_A           34 IVTLIGANGAGKTTTLSA   51 (240)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1

Probab=96.76  E-value=0.00084  Score=42.42  Aligned_cols=20  Identities=20%  Similarity=0.386  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++.++|++|+|||+|+..
T Consensus       170 g~k~~IvG~nGsGKSTLlk~  189 (365)
T 1lw7_A          170 AKTVAILGGESSGKSVLVNK  189 (365)
T ss_dssp             CEEEEEECCTTSHHHHHHHH
T ss_pred             hCeEEEECCCCCCHHHHHHH
Confidence            46889999999999999974

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}

Probab=96.76  E-value=0.00086  Score=41.45  Aligned_cols=18  Identities=33%  Similarity=0.482  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        49 ~~~liG~NGsGKSTLlk~   66 (279)
T 2ihy_A           49 KWILYGLNGAGKTTLLNI   66 (279)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367999999999999973

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}

Probab=96.76  E-value=0.00077  Score=41.37  Aligned_cols=17  Identities=24%  Similarity=0.546  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        40 ~~liG~nGsGKSTLl~~   56 (266)
T 4g1u_C           40 VAIIGPNGAGKSTLLRL   56 (266)
T ss_dssp             EEEECCTTSCHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            57899999999999973

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}

Probab=96.76  E-value=0.00076  Score=41.26  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+++..
T Consensus        26 ~~v~i~Gp~GsGKSTll~~   44 (261)
T 2eyu_A           26 GLILVTGPTGSGKSTTIAS   44 (261)
T ss_dssp             EEEEEECSTTCSHHHHHHH
T ss_pred             CEEEEECCCCccHHHHHHH
Confidence            3578999999999999974

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12

Probab=96.75  E-value=0.00081  Score=40.15  Aligned_cols=17  Identities=29%  Similarity=0.444  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        38 ~~iiG~NGsGKSTLlk~   54 (214)
T 1sgw_A           38 VNFHGPNGIGKTTLLKT   54 (214)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999999973

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}

Probab=96.75  E-value=0.001  Score=37.75  Aligned_cols=19  Identities=21%  Similarity=0.272  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||++...
T Consensus         6 ~~i~l~G~~GsGKst~a~~   24 (185)
T 3trf_A            6 TNIYLIGLMGAGKTSVGSQ   24 (185)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4688999999999999985

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}

Probab=96.75  E-value=0.00088  Score=40.91  Aligned_cols=18  Identities=33%  Similarity=0.649  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        48 ~~~i~G~nGsGKSTLl~~   65 (260)
T 2ghi_A           48 TCALVGHTGSGKSTIAKL   65 (260)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*

Probab=96.74  E-value=0.00089  Score=41.14  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        47 ~~~i~G~nGsGKSTLlk~   64 (271)
T 2ixe_A           47 VTALVGPNGSGKSTVAAL   64 (271)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*

Probab=96.74  E-value=0.00084  Score=40.06  Aligned_cols=17  Identities=47%  Similarity=0.651  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++..
T Consensus        52 ~ll~G~~G~GKTtl~~~   68 (254)
T 1ixz_A           52 VLLVGPPGVGKTHLARA   68 (254)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            89999999999999974

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*

Probab=96.73  E-value=0.00064  Score=39.50  Aligned_cols=18  Identities=33%  Similarity=0.407  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|++|+|||+|+..
T Consensus        27 ~~~l~G~nGsGKSTll~~   44 (231)
T 4a74_A           27 ITEVFGEFGSGKTQLAHT   44 (231)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999975

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}

Probab=96.73  E-value=0.00079  Score=39.98  Aligned_cols=18  Identities=33%  Similarity=0.329  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        24 ~~~liG~nGsGKSTLl~~   41 (208)
T 3b85_A           24 IVFGLGPAGSGKTYLAMA   41 (208)
T ss_dssp             EEEEECCTTSSTTHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*

Probab=96.73  E-value=0.00094  Score=40.48  Aligned_cols=18  Identities=22%  Similarity=0.270  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLlk~   48 (250)
T 2d2e_A           31 VHALMGPNGAGKSTLGKI   48 (250)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A

Probab=96.73  E-value=0.00096  Score=40.89  Aligned_cols=18  Identities=22%  Similarity=0.410  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        48 ~~~l~G~NGsGKSTLlk~   65 (267)
T 2zu0_C           48 VHAIMGPNGSGKSTLSAT   65 (267)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}

Probab=96.72  E-value=0.0007  Score=37.78  Aligned_cols=19  Identities=32%  Similarity=0.572  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        44 ~~vll~G~~G~GKT~la~~   62 (187)
T 2p65_A           44 NNPILLGDPGVGKTAIVEG   62 (187)
T ss_dssp             CEEEEESCGGGCHHHHHHH
T ss_pred             CceEEECCCCCCHHHHHHH
Confidence            3578999999999999975

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C

Probab=96.72  E-value=0.00099  Score=40.56  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~liG~NGsGKSTLlk~   45 (249)
T 2qi9_C           28 ILHLVGPNGAGKSTLLAR   45 (249)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367999999999999974

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12

Probab=96.69  E-value=0.00093  Score=40.82  Aligned_cols=18  Identities=22%  Similarity=0.303  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        43 i~~l~G~NGsGKSTLlk~   60 (256)
T 1vpl_A           43 IFGLIGPNGAGKTTTLRI   60 (256)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973

>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae}

Probab=96.69  E-value=0.0026  Score=41.03  Aligned_cols=22  Identities=27%  Similarity=0.356  Sum_probs=18.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhc
Q psy15257         13 VKCVVVGDTAVGKTRLICARACN   35 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~   35 (65)
                      ..|.++|.++||||||+.+ +++
T Consensus        73 a~V~ivG~PNvGKSTL~n~-Lt~   94 (376)
T 4a9a_A           73 ASVGFVGFPSVGKSTLLSK-LTG   94 (376)
T ss_dssp             EEEEEECCCCHHHHHHHHH-HHS
T ss_pred             CeEEEECCCCCCHHHHHHH-HhC
Confidence            5799999999999999984 444

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A

Probab=96.68  E-value=0.0011  Score=38.53  Aligned_cols=19  Identities=32%  Similarity=0.372  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        53 ~~~ll~G~~G~GKT~la~~   71 (242)
T 3bos_A           53 QAIYLWGPVKSGRTHLIHA   71 (242)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}

Probab=96.67  E-value=0.00096  Score=40.81  Aligned_cols=18  Identities=33%  Similarity=0.492  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~liG~nGsGKSTLl~~   52 (266)
T 2yz2_A           35 CLLVAGNTGSGKSTLLQI   52 (266)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999973

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*

Probab=96.67  E-value=0.0011  Score=38.64  Aligned_cols=19  Identities=26%  Similarity=0.258  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++.++|++|+|||+++..
T Consensus         6 ~~i~i~G~~GsGKSTl~~~   24 (227)
T 1cke_A            6 PVITIDGPSGAGKGTLCKA   24 (227)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4799999999999999974

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}

Probab=96.66  E-value=0.0011  Score=40.64  Aligned_cols=18  Identities=39%  Similarity=0.671  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~NGsGKSTLlk~   49 (263)
T 2pjz_A           32 KVIILGPNGSGKTTLLRA   49 (263)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            567999999999999974

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*

Probab=96.66  E-value=0.001  Score=41.58  Aligned_cols=19  Identities=42%  Similarity=0.490  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+++..
T Consensus       103 ~vi~lvG~nGsGKTTll~~  121 (304)
T 1rj9_A          103 RVVLVVGVNGVGKTTTIAK  121 (304)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             eEEEEECCCCCcHHHHHHH
Confidence            4678899999999999985

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}

Probab=96.66  E-value=0.00096  Score=42.76  Aligned_cols=17  Identities=24%  Similarity=0.423  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        44 ~~llGpnGsGKSTLLr~   60 (355)
T 1z47_A           44 VGLLGPSGSGKTTILRL   60 (355)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67899999999999973

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}

Probab=96.65  E-value=0.0012  Score=44.17  Aligned_cols=22  Identities=27%  Similarity=0.309  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++++|..++|||||+.+
T Consensus        63 ~~~~~V~vvG~~n~GKSTLIN~   84 (550)
T 2qpt_A           63 DGKPMVLVAGQYSTGKTSFIQY   84 (550)
T ss_dssp             SSCCEEEEEEBTTSCHHHHHHH
T ss_pred             cCCcEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999996

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*

Probab=96.65  E-value=0.001  Score=38.56  Aligned_cols=19  Identities=42%  Similarity=0.407  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus         7 ~~i~i~G~~GsGKSTl~~~   25 (211)
T 3asz_A            7 FVIGIAGGTASGKTTLAQA   25 (211)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            5688999999999999974

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1

Probab=96.65  E-value=0.0016  Score=36.51  Aligned_cols=19  Identities=16%  Similarity=0.184  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||++..+
T Consensus         3 ~~I~i~G~~GsGKST~a~~   21 (181)
T 1ly1_A            3 KIILTIGCPGSGKSTWARE   21 (181)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEecCCCCCHHHHHHH
Confidence            3588999999999999985

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}

Probab=96.65  E-value=0.00078  Score=37.92  Aligned_cols=18  Identities=33%  Similarity=0.442  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        38 ~~~l~G~~G~GKTtL~~~   55 (149)
T 2kjq_A           38 FIYVWGEEGAGKSHLLQA   55 (149)
T ss_dssp             EEEEESSSTTTTCHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999974

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}

Probab=96.64  E-value=0.0012  Score=38.19  Aligned_cols=19  Identities=32%  Similarity=0.293  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|.+|+|||+++..
T Consensus        19 ~~I~l~G~~GsGKSTla~~   37 (202)
T 3t61_A           19 GSIVVMGVSGSGKSSVGEA   37 (202)
T ss_dssp             SCEEEECSTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}

Probab=96.64  E-value=0.001  Score=42.72  Aligned_cols=17  Identities=24%  Similarity=0.544  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        32 ~~llGpnGsGKSTLLr~   48 (362)
T 2it1_A           32 MALLGPSGSGKSTLLYT   48 (362)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCchHHHHHHH
Confidence            67899999999999973

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}

Probab=96.64  E-value=0.00099  Score=42.72  Aligned_cols=17  Identities=24%  Similarity=0.452  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        32 ~~llGpnGsGKSTLLr~   48 (359)
T 2yyz_A           32 VALLGPSGCGKTTTLLM   48 (359)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEEcCCCchHHHHHHH
Confidence            67899999999999973

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}

Probab=96.64  E-value=0.00077  Score=43.31  Aligned_cols=17  Identities=29%  Similarity=0.595  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        33 ~~llGpsGsGKSTLLr~   49 (359)
T 3fvq_A           33 LFIIGASGCGKTTLLRC   49 (359)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCchHHHHHHH
Confidence            67899999999999973

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}

Probab=96.64  E-value=0.0012  Score=40.22  Aligned_cols=18  Identities=28%  Similarity=0.440  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~l~G~nGsGKSTLl~~   50 (253)
T 2nq2_C           33 ILAVLGQNGCGKSTLLDL   50 (253)
T ss_dssp             EEEEECCSSSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*

Probab=96.62  E-value=0.0011  Score=42.75  Aligned_cols=17  Identities=29%  Similarity=0.473  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        40 ~~llGpnGsGKSTLLr~   56 (372)
T 1v43_A           40 LVLLGPSGCGKTTTLRM   56 (372)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCChHHHHHHH
Confidence            57899999999999973

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A

Probab=96.62  E-value=0.001  Score=42.74  Aligned_cols=17  Identities=24%  Similarity=0.479  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        32 ~~llGpnGsGKSTLLr~   48 (372)
T 1g29_1           32 MILLGPSGCGKTTTLRM   48 (372)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCcHHHHHHHH
Confidence            67899999999999973

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}

Probab=96.62  E-value=0.0013  Score=38.16  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++.|++|+|||+++..
T Consensus         2 ~I~l~G~~GsGKsT~a~~   19 (216)
T 3fb4_A            2 NIVLMGLPGAGKGTQAEQ   19 (216)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            689999999999999975

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A

Probab=96.62  E-value=0.0011  Score=42.97  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        32 ~~llGpsGsGKSTLLr~   48 (381)
T 3rlf_A           32 VVFVGPSGCGKSTLLRM   48 (381)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEEcCCCchHHHHHHH
Confidence            67899999999999973

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*

Probab=96.61  E-value=0.0014  Score=37.39  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|..|+|||+++..
T Consensus         2 ~I~i~G~~GsGKsT~~~~   19 (205)
T 2jaq_A            2 KIAIFGTVGAGKSTISAE   19 (205)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCccCHHHHHHH
Confidence            588999999999999875

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*

Probab=96.61  E-value=0.0014  Score=38.18  Aligned_cols=18  Identities=22%  Similarity=0.154  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++.|+.|+|||++..+
T Consensus         2 ~I~l~G~~GsGKsT~a~~   19 (216)
T 3dl0_A            2 NLVLMGLPGAGKGTQGER   19 (216)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            689999999999999975

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}

Probab=96.60  E-value=0.0013  Score=37.84  Aligned_cols=19  Identities=37%  Similarity=0.412  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        55 ~~~~l~G~~GtGKT~la~~   73 (202)
T 2w58_A           55 KGLYLHGSFGVGKTYLLAA   73 (202)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4688999999999999874

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A

Probab=96.59  E-value=0.0015  Score=36.91  Aligned_cols=19  Identities=32%  Similarity=0.223  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||++...
T Consensus         4 ~~I~i~G~~GsGKsT~~~~   22 (192)
T 1kht_A            4 KVVVVTGVPGVGSTTSSQL   22 (192)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4689999999999999875

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1

Probab=96.59  E-value=0.0013  Score=37.10  Aligned_cols=18  Identities=28%  Similarity=0.464  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++.|.+|+|||+++.+
T Consensus         3 ~I~i~G~~GsGKsT~~~~   20 (194)
T 1nks_A            3 IGIVTGIPGVGKSTVLAK   20 (194)
T ss_dssp             EEEEEECTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999975

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}

Probab=96.58  E-value=0.0014  Score=37.30  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus        41 ~ll~G~~G~GKT~l~~~   57 (226)
T 2chg_A           41 LLFSGPPGTGKTATAIA   57 (226)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            89999999999999975

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12

Probab=96.58  E-value=0.0009  Score=42.72  Aligned_cols=18  Identities=33%  Similarity=0.466  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~llGpnGsGKSTLLr~   45 (348)
T 3d31_A           28 YFVILGPTGAGKTLFLEL   45 (348)
T ss_dssp             EEEEECCCTHHHHHHHHH
T ss_pred             EEEEECCCCccHHHHHHH
Confidence            367899999999999973

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*

Probab=96.58  E-value=0.0014  Score=37.63  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++..
T Consensus        47 ~~ll~G~~G~GKT~l~~~   64 (250)
T 1njg_A           47 AYLFSGTRGVGKTSIARL   64 (250)
T ss_dssp             EEEEECSTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478899999999999975

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*

Probab=96.58  E-value=0.00097  Score=41.88  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        82 ~vaivG~sGsGKSTLl~l   99 (306)
T 3nh6_A           82 TLALVGPSGAGKSTILRL   99 (306)
T ss_dssp             EEEEESSSCHHHHHHHHH
T ss_pred             EEEEECCCCchHHHHHHH
Confidence            478999999999999973

>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus}

Probab=96.57  E-value=0.0045  Score=40.27  Aligned_cols=23  Identities=26%  Similarity=0.416  Sum_probs=20.3

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++++|..++|||+|+.+
T Consensus        14 ~k~~~~i~iiG~~d~GKSTL~~~   36 (439)
T 3j2k_7           14 KKEHVNVVFIGHVDAGKSTIGGQ   36 (439)
T ss_pred             CCceeEEEEEeCCCCCHHHHHHH
Confidence            34568999999999999999986

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20

Probab=96.57  E-value=0.0013  Score=39.89  Aligned_cols=17  Identities=47%  Similarity=0.651  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+|+..
T Consensus        76 vll~Gp~GtGKTtl~~~   92 (278)
T 1iy2_A           76 VLLVGPPGVGKTHLARA   92 (278)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCcChHHHHHHH
Confidence            89999999999999974

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*

Probab=96.56  E-value=0.0013  Score=41.31  Aligned_cols=18  Identities=22%  Similarity=0.307  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus       128 ~vaIvGpsGsGKSTLl~l  145 (305)
T 2v9p_A          128 CLAFIGPPNTGKSMLCNS  145 (305)
T ss_dssp             EEEEECSSSSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            678999999999999974

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}

Probab=96.56  E-value=0.0013  Score=40.99  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+++..
T Consensus       101 ~vi~lvG~nGsGKTTll~~  119 (302)
T 3b9q_A          101 AVIMIVGVNGGGKTTSLGK  119 (302)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             cEEEEEcCCCCCHHHHHHH
Confidence            4678999999999999985

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A

Probab=96.56  E-value=0.0019  Score=37.28  Aligned_cols=22  Identities=14%  Similarity=0.294  Sum_probs=18.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....|++.|..|+|||++...
T Consensus        18 ~~~~~I~l~G~~GsGKST~a~~   39 (201)
T 2cdn_A           18 GSHMRVLLLGPPGAGKGTQAVK   39 (201)
T ss_dssp             CSCCEEEEECCTTSSHHHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHHHH
Confidence            3446799999999999999875

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*

Probab=96.56  E-value=0.002  Score=38.19  Aligned_cols=21  Identities=19%  Similarity=0.360  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||+++..
T Consensus        19 ~g~~i~i~G~~GsGKSTl~~~   39 (230)
T 2vp4_A           19 QPFTVLIEGNIGSGKTTYLNH   39 (230)
T ss_dssp             CCEEEEEECSTTSCHHHHHHT
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            345788999999999999974

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*

Probab=96.55  E-value=0.0019  Score=39.81  Aligned_cols=20  Identities=30%  Similarity=0.336  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+++.|++|+|||+++.+
T Consensus        33 ~~livl~G~sGsGKSTla~~   52 (287)
T 1gvn_B           33 PTAFLLGGQPGSGKTSLRSA   52 (287)
T ss_dssp             CEEEEEECCTTSCTHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            45688999999999999985

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*

Probab=96.54  E-value=0.001  Score=37.67  Aligned_cols=18  Identities=28%  Similarity=0.338  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++|++|+|||+++..
T Consensus        28 ~~~i~G~NGsGKStll~a   45 (182)
T 3kta_A           28 FTAIVGANGSGKSNIGDA   45 (182)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            357889999999999975

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}

Probab=96.53  E-value=0.0013  Score=40.81  Aligned_cols=18  Identities=28%  Similarity=0.776  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus       167 i~~l~G~sG~GKSTLln~  184 (302)
T 2yv5_A          167 ICILAGPSGVGKSSILSR  184 (302)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468899999999999985

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20

Probab=96.52  E-value=0.0015  Score=38.96  Aligned_cols=19  Identities=37%  Similarity=0.412  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        46 ~~vll~G~~GtGKT~la~~   64 (257)
T 1lv7_A           46 KGVLMVGPPGTGKTLLAKA   64 (257)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             CeEEEECcCCCCHHHHHHH
Confidence            3589999999999999975

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8

Probab=96.51  E-value=0.0014  Score=40.58  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus       171 iv~l~G~sG~GKSTll~~  188 (301)
T 1u0l_A          171 ISTMAGLSGVGKSSLLNA  188 (301)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            467899999999999975

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}

Probab=96.50  E-value=0.0016  Score=37.64  Aligned_cols=18  Identities=22%  Similarity=0.283  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|+..
T Consensus        25 ~~~i~G~~GsGKTtl~~~   42 (235)
T 2w0m_A           25 FIALTGEPGTGKTIFSLH   42 (235)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467889999999999975

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*

Probab=96.50  E-value=0.0014  Score=40.97  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+|+..
T Consensus        53 ~~ll~Gp~G~GKTTLa~~   70 (334)
T 1in4_A           53 HVLLAGPPGLGKTTLAHI   70 (334)
T ss_dssp             CEEEESSTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            478899999999999974

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}

Probab=96.50  E-value=0.0014  Score=40.16  Aligned_cols=17  Identities=35%  Similarity=0.454  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+|+..
T Consensus        47 vlL~Gp~GtGKTtLaka   63 (274)
T 2x8a_A           47 VLLAGPPGCGKTLLAKA   63 (274)
T ss_dssp             EEEESSTTSCHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            89999999999999974

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A

Probab=96.50  E-value=0.0019  Score=36.60  Aligned_cols=19  Identities=32%  Similarity=0.368  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||+++..
T Consensus        12 ~~i~i~G~~GsGKst~~~~   30 (180)
T 3iij_A           12 PNILLTGTPGVGKTTLGKE   30 (180)
T ss_dssp             CCEEEECSTTSSHHHHHHH
T ss_pred             CeEEEEeCCCCCHHHHHHH
Confidence            4688999999999999985

>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A*

Probab=96.49  E-value=0.0033  Score=41.44  Aligned_cols=22  Identities=23%  Similarity=0.208  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|..++|||||+.+
T Consensus        17 m~~~~I~iiG~~d~GKSTLi~~   38 (482)
T 1wb1_A           17 FKNINLGIFGHIDHGKTTLSKV   38 (482)
T ss_dssp             CEEEEEEEEECTTSSHHHHHHH
T ss_pred             CCCCEEEEECCCCChHHHHHHH
Confidence            3468999999999999999986

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}

Probab=96.49  E-value=0.0029  Score=36.02  Aligned_cols=21  Identities=19%  Similarity=0.202  Sum_probs=17.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++.|.+|+|||+++..
T Consensus        12 ~~~~i~l~G~~GsGKsT~~~~   32 (186)
T 2yvu_A           12 KGIVVWLTGLPGSGKTTIATR   32 (186)
T ss_dssp             CCEEEEEECCTTSSHHHHHHH
T ss_pred             CCcEEEEEcCCCCCHHHHHHH
Confidence            346789999999999999975

>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A*

Probab=96.47  E-value=0.0013  Score=43.21  Aligned_cols=21  Identities=29%  Similarity=0.463  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+.++|||||+.+
T Consensus        32 ~~~ki~iiG~~~~GKSTLi~~   52 (483)
T 3p26_A           32 PHLSFVVLGHVDAGKSTLMGR   52 (483)
T ss_dssp             CEEEEEEESCGGGTHHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            468999999999999999986

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A

Probab=96.47  E-value=0.0018  Score=37.54  Aligned_cols=19  Identities=21%  Similarity=0.141  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|++|+|||+++.+
T Consensus         7 ~~i~i~G~sGsGKTTl~~~   25 (174)
T 1np6_A            7 PLLAFAAWSGTGKTTLLKK   25 (174)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             eEEEEEeCCCCCHHHHHHH
Confidence            3578899999999999985

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}

Probab=96.45  E-value=0.0029  Score=40.03  Aligned_cols=20  Identities=20%  Similarity=0.295  Sum_probs=18.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|.+|+|||||+.+
T Consensus        74 ~~~v~lvG~pgaGKSTLln~   93 (349)
T 2www_A           74 AFRVGLSGPPGAGKSTFIEY   93 (349)
T ss_dssp             CEEEEEECCTTSSHHHHHHH
T ss_pred             ceEEEEEcCCCCCHHHHHHH
Confidence            57899999999999999985

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*

Probab=96.45  E-value=0.0014  Score=40.79  Aligned_cols=18  Identities=39%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        66 ~~~i~G~NGsGKSTLlk~   83 (290)
T 2bbs_A           66 LLAVAGSTGAGKTSLLMM   83 (290)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            467999999999999973

>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae}

Probab=96.45  E-value=0.002  Score=43.71  Aligned_cols=22  Identities=27%  Similarity=0.418  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|+.++|||||+.+
T Consensus       165 k~~lkV~ivG~~n~GKSTLin~  186 (611)
T 3izq_1          165 LPHLSFVVLGHVDAGKSTLMGR  186 (611)
T ss_dssp             CCCCEEEEECCSSSCHHHHHHH
T ss_pred             CCceEEEEEECCCCCHHHHHHH
Confidence            3468999999999999999986

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}

Probab=96.43  E-value=0.0014  Score=42.44  Aligned_cols=18  Identities=33%  Similarity=0.588  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        49 ~~~llGpsGsGKSTLLr~   66 (390)
T 3gd7_A           49 RVGLLGRTGSGKSTLLSA   66 (390)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            367999999999999963

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}

Probab=96.43  E-value=0.0015  Score=37.61  Aligned_cols=19  Identities=16%  Similarity=0.284  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++.++|++|+|||+++..
T Consensus         2 ~~i~i~G~~GsGKSTl~~~   20 (204)
T 2if2_A            2 KRIGLTGNIGCGKSTVAQM   20 (204)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             eEEEEECCCCcCHHHHHHH
Confidence            3689999999999999974

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V

Probab=96.42  E-value=0.0016  Score=41.80  Aligned_cols=18  Identities=33%  Similarity=0.606  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||||+..
T Consensus       217 ~~~lvG~sG~GKSTLln~  234 (358)
T 2rcn_A          217 ISIFAGQSGVGKSSLLNA  234 (358)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCccHHHHHHH
Confidence            578999999999999985

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}

Probab=96.41  E-value=0.0029  Score=35.77  Aligned_cols=20  Identities=15%  Similarity=0.184  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|..|+|||++...
T Consensus         4 g~~I~l~G~~GsGKST~~~~   23 (186)
T 3cm0_A            4 GQAVIFLGPPGAGKGTQASR   23 (186)
T ss_dssp             EEEEEEECCTTSCHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            35789999999999999874

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1

Probab=96.41  E-value=0.0023  Score=36.91  Aligned_cols=19  Identities=21%  Similarity=0.212  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.+.++|++|+|||++...
T Consensus         3 ~~i~l~G~~GsGKST~~~~   21 (206)
T 1jjv_A            3 YIVGLTGGIGSGKTTIANL   21 (206)
T ss_dssp             EEEEEECSTTSCHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A

Probab=96.41  E-value=0.002  Score=38.95  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||++..+
T Consensus         3 li~I~G~~GSGKSTla~~   20 (253)
T 2ze6_A            3 LHLIYGPTCSGKTDMAIQ   20 (253)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCcCHHHHHHH
Confidence            478899999999999975

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*

Probab=96.40  E-value=0.0018  Score=40.60  Aligned_cols=21  Identities=29%  Similarity=0.203  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.++|++|+|||+|+..
T Consensus        89 ~g~ivgI~G~sGsGKSTL~~~  109 (312)
T 3aez_A           89 VPFIIGVAGSVAVGKSTTARV  109 (312)
T ss_dssp             CCEEEEEECCTTSCHHHHHHH
T ss_pred             CCEEEEEECCCCchHHHHHHH
Confidence            346788999999999999974

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*

Probab=96.40  E-value=0.00093  Score=42.67  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~llGpnGsGKSTLLr~   50 (353)
T 1oxx_K           33 RFGILGPSGAGKTTFMRI   50 (353)
T ss_dssp             EEEEECSCHHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999973

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}

Probab=96.38  E-value=0.0019  Score=38.88  Aligned_cols=19  Identities=32%  Similarity=0.317  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        52 ~~~ll~G~~GtGKT~la~~   70 (285)
T 3h4m_A           52 KGILLYGPPGTGKTLLAKA   70 (285)
T ss_dssp             SEEEEESSSSSSHHHHHHH
T ss_pred             CeEEEECCCCCcHHHHHHH
Confidence            3589999999999999975

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}

Probab=96.38  E-value=0.002  Score=35.62  Aligned_cols=19  Identities=11%  Similarity=0.118  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||.++..
T Consensus        25 ~~vll~G~~GtGKt~lA~~   43 (145)
T 3n70_A           25 IAVWLYGAPGTGRMTGARY   43 (145)
T ss_dssp             SCEEEESSTTSSHHHHHHH
T ss_pred             CCEEEECCCCCCHHHHHHH
Confidence            4589999999999999974

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C

Probab=96.37  E-value=0.0019  Score=41.63  Aligned_cols=16  Identities=38%  Similarity=0.584  Sum_probs=14.6

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +.++|++|+|||+|+.
T Consensus        57 ~~IiGpnGaGKSTLlr   72 (366)
T 3tui_C           57 YGVIGASGAGKSTLIR   72 (366)
T ss_dssp             EEEECCTTSSHHHHHH
T ss_pred             EEEEcCCCchHHHHHH
Confidence            5789999999999996

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6

Probab=96.37  E-value=0.0034  Score=38.95  Aligned_cols=21  Identities=14%  Similarity=0.009  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||+++..
T Consensus        30 ~~~ii~I~G~sGsGKSTla~~   50 (290)
T 1odf_A           30 CPLFIFFSGPQGSGKSFTSIQ   50 (290)
T ss_dssp             SCEEEEEECCTTSSHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            456889999999999999974

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}

Probab=96.37  E-value=0.0021  Score=38.04  Aligned_cols=19  Identities=32%  Similarity=0.396  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        40 ~~vll~G~~GtGKT~la~~   58 (262)
T 2qz4_A           40 KGALLLGPPGCGKTLLAKA   58 (262)
T ss_dssp             CEEEEESCTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            3588999999999999975

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}

Probab=96.36  E-value=0.0022  Score=36.34  Aligned_cols=19  Identities=42%  Similarity=0.478  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||++...
T Consensus         6 ~~I~l~G~~GsGKST~~~~   24 (193)
T 2rhm_A            6 ALIIVTGHPATGKTTLSQA   24 (193)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*

Probab=96.36  E-value=0.0038  Score=39.43  Aligned_cols=21  Identities=29%  Similarity=0.338  Sum_probs=18.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|..|+|||+++.+
T Consensus        78 ~~~~I~i~G~~G~GKSTl~~~   98 (355)
T 3p32_A           78 NAHRVGITGVPGVGKSTAIEA   98 (355)
T ss_dssp             CSEEEEEECCTTSSHHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            346899999999999999986

>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8

Probab=96.36  E-value=0.0022  Score=39.59  Aligned_cols=21  Identities=29%  Similarity=0.575  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.++||||||+.+
T Consensus       119 ~~~~v~~vG~~nvGKSsliN~  139 (282)
T 1puj_A          119 RAIRALIIGIPNVGKSTLINR  139 (282)
T ss_dssp             CCEEEEEEESTTSSHHHHHHH
T ss_pred             CCceEEEEecCCCchHHHHHH
Confidence            457899999999999999986

>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii}

Probab=96.34  E-value=0.0035  Score=41.88  Aligned_cols=22  Identities=18%  Similarity=0.184  Sum_probs=19.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++++|.+++|||||+.+
T Consensus        11 ~~~r~IaIiG~~~aGKTTL~~~   32 (528)
T 3tr5_A           11 AMRRTFAIISHPDAGKTTLTEK   32 (528)
T ss_dssp             HTEEEEEEEECTTSSHHHHHHH
T ss_pred             hcCCEEEEECCCCCcHHHHHHH
Confidence            3467999999999999999986

>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ...

Probab=96.33  E-value=0.0027  Score=40.66  Aligned_cols=22  Identities=32%  Similarity=0.398  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|+.++|||||+.+
T Consensus         9 ~~~~~I~iiG~~~~GKSTLi~~   30 (405)
T 2c78_A            9 KPHVNVGTIGHVDHGKTTLTAA   30 (405)
T ss_dssp             CCEEEEEEECSTTSSHHHHHHH
T ss_pred             CCeEEEEEEcCCCCCHHHHHHH
Confidence            3568999999999999999986

>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A*

Probab=96.33  E-value=0.0021  Score=41.68  Aligned_cols=21  Identities=24%  Similarity=0.455  Sum_probs=19.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|+.++|||||+.+
T Consensus         5 ~~~~I~iiG~~~~GKSTLi~~   25 (435)
T 1jny_A            5 PHLNLIVIGHVDHGKSTLVGR   25 (435)
T ss_dssp             CEEEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEEEEeCCCCCHHHHHHH
Confidence            468999999999999999996

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}

Probab=96.31  E-value=0.0023  Score=41.06  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+++..
T Consensus       158 ~vi~lvG~nGsGKTTll~~  176 (359)
T 2og2_A          158 AVIMIVGVNGGGKTTSLGK  176 (359)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             eEEEEEcCCCChHHHHHHH
Confidence            4678999999999999985

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}

Probab=96.31  E-value=0.001  Score=38.49  Aligned_cols=18  Identities=39%  Similarity=0.514  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus         4 ~v~IvG~SGsGKSTL~~~   21 (171)
T 2f1r_A            4 ILSIVGTSDSGKTTLITR   21 (171)
T ss_dssp             EEEEEESCHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A*

Probab=96.31  E-value=0.0022  Score=43.98  Aligned_cols=21  Identities=29%  Similarity=0.542  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++|+++|+.++|||||+.+
T Consensus        68 ~~~~V~VvG~~naGKSSLlNa   88 (695)
T 2j69_A           68 GVFRLLVLGDMKRGKSTFLNA   88 (695)
T ss_dssp             CCEEEEEECCTTSCHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            468999999999999999986

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}

Probab=96.30  E-value=0.0032  Score=37.73  Aligned_cols=21  Identities=14%  Similarity=0.139  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++.|++|+|||++..+
T Consensus        28 ~~~~I~l~G~~GsGKsT~a~~   48 (243)
T 3tlx_A           28 PDGRYIFLGAPGSGKGTQSLN   48 (243)
T ss_dssp             CCEEEEEECCTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            346899999999999999985

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*

Probab=96.30  E-value=0.0023  Score=39.43  Aligned_cols=18  Identities=33%  Similarity=0.514  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        39 ~lll~G~~GtGKT~la~~   56 (324)
T 1l8q_A           39 PIFIYGSVGTGKTHLLQA   56 (324)
T ss_dssp             SEEEECSSSSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            578899999999999975

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}

Probab=96.29  E-value=0.0026  Score=38.29  Aligned_cols=19  Identities=32%  Similarity=0.263  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus        28 ~~I~I~G~~GsGKSTl~k~   46 (252)
T 4e22_A           28 PVITVDGPSGAGKGTLCKA   46 (252)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4789999999999999974

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1

Probab=96.29  E-value=0.0031  Score=36.06  Aligned_cols=19  Identities=21%  Similarity=0.445  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|..|+|||++...
T Consensus        11 ~~I~l~G~~GsGKSTv~~~   29 (184)
T 1y63_A           11 INILITGTPGTGKTSMAEM   29 (184)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5799999999999999974

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*

Probab=96.29  E-value=0.0021  Score=41.00  Aligned_cols=18  Identities=33%  Similarity=0.492  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus       125 ~i~I~GptGSGKTTlL~~  142 (356)
T 3jvv_A          125 LVLVTGPTGSGKSTTLAA  142 (356)
T ss_dssp             EEEEECSTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999974

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}

Probab=96.29  E-value=0.0025  Score=38.90  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.|+|||+|+.+
T Consensus        33 ~v~i~G~~G~GKT~Ll~~   50 (350)
T 2qen_A           33 LTLLLGIRRVGKSSLLRA   50 (350)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEECCCcCCHHHHHHH
Confidence            578899999999999985

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*

Probab=96.28  E-value=0.0044  Score=35.59  Aligned_cols=21  Identities=19%  Similarity=0.237  Sum_probs=17.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++.|..|+|||++..+
T Consensus        14 ~~~~I~l~G~~GsGKsT~~~~   34 (203)
T 1ukz_A           14 QVSVIFVLGGPGAGKGTQCEK   34 (203)
T ss_dssp             TCEEEEEECSTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            345789999999999999874

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11

Probab=96.28  E-value=0.0027  Score=37.17  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|++|+|||+|+..
T Consensus        26 ~~~i~G~~GsGKTtl~~~   43 (243)
T 1n0w_A           26 ITEMFGEFRTGKTQICHT   43 (243)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            467899999999999985

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}

Probab=96.28  E-value=0.0045  Score=39.12  Aligned_cols=22  Identities=23%  Similarity=0.179  Sum_probs=18.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+-+.++|++|+|||+++..
T Consensus        90 ~~p~iigI~GpsGSGKSTl~~~  111 (321)
T 3tqc_A           90 KVPYIIGIAGSVAVGKSTTSRV  111 (321)
T ss_dssp             CCCEEEEEECCTTSSHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHH
Confidence            3456788999999999999974

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*

Probab=96.28  E-value=0.0026  Score=38.42  Aligned_cols=19  Identities=32%  Similarity=0.504  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        51 ~~vll~G~~GtGKT~la~~   69 (310)
T 1ofh_A           51 KNILMIGPTGVGKTEIARR   69 (310)
T ss_dssp             CCEEEECCTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4588999999999999975

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*

Probab=96.27  E-value=0.0031  Score=36.47  Aligned_cols=20  Identities=30%  Similarity=0.194  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++..
T Consensus        21 ~~~i~i~G~~GsGKSTl~~~   40 (207)
T 2qt1_A           21 TFIIGISGVTNSGKTTLAKN   40 (207)
T ss_dssp             CEEEEEEESTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            46788999999999999974

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}

Probab=96.27  E-value=0.0024  Score=38.75  Aligned_cols=19  Identities=32%  Similarity=0.303  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        55 ~~vll~Gp~GtGKT~la~~   73 (297)
T 3b9p_A           55 KGLLLFGPPGNGKTLLARA   73 (297)
T ss_dssp             SEEEEESSSSSCHHHHHHH
T ss_pred             CeEEEECcCCCCHHHHHHH
Confidence            4688999999999999975

>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}

Probab=96.25  E-value=0.0032  Score=42.53  Aligned_cols=22  Identities=27%  Similarity=0.484  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|..++|||||+.+
T Consensus       175 k~~~~I~iiG~~d~GKSTLi~~  196 (592)
T 3mca_A          175 KPVVHLVVTGHVDSGKSTMLGR  196 (592)
T ss_dssp             CCEEEEEEECCSSSTHHHHHHH
T ss_pred             CCccEEEEEcCCCCCHHHHHHH
Confidence            4568999999999999999986

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}

Probab=96.25  E-value=0.0026  Score=40.74  Aligned_cols=18  Identities=39%  Similarity=0.543  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|..+
T Consensus        42 lIvI~GPTgsGKTtLa~~   59 (339)
T 3a8t_A           42 LLVLMGATGTGKSRLSID   59 (339)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999986

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}

Probab=96.25  E-value=0.0037  Score=35.81  Aligned_cols=19  Identities=21%  Similarity=0.139  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|..|+|||+++..
T Consensus         5 ~~I~i~G~~GsGKsT~~~~   23 (213)
T 2plr_A            5 VLIAFEGIDGSGKSSQATL   23 (213)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEEcCCCCCHHHHHHH
Confidence            5789999999999999975

>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A*

Probab=96.25  E-value=0.0031  Score=40.36  Aligned_cols=20  Identities=35%  Similarity=0.421  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++++|+.++|||||+.+
T Consensus         3 ~~~I~iiG~~~~GKSTLi~~   22 (397)
T 1d2e_A            3 HVNVGTIGHVDHGKTTLTAA   22 (397)
T ss_dssp             EEEEEEESSTTSSHHHHHHH
T ss_pred             eEEEEEEeCCCCCHHHHHHH
Confidence            58999999999999999986

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*

Probab=96.24  E-value=0.0026  Score=40.65  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+++..
T Consensus       137 ~~i~ivG~~GsGKTTll~~  155 (372)
T 2ewv_A          137 GLILVTGPTGSGKSTTIAS  155 (372)
T ss_dssp             EEEEEECSSSSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3588999999999999974

>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A*

Probab=96.24  E-value=0.0033  Score=40.21  Aligned_cols=22  Identities=27%  Similarity=0.489  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++++|.+++|||+++.+
T Consensus        31 ~~~~killlG~~~SGKST~~kq   52 (362)
T 1zcb_A           31 ARLVKILLLGAGESGKSTFLKQ   52 (362)
T ss_dssp             CCCEEEEEECSTTSSHHHHHHH
T ss_pred             cCccEEEEECCCCCcHHHHHHH
Confidence            4468999999999999999986

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1

Probab=96.24  E-value=0.0029  Score=36.12  Aligned_cols=20  Identities=15%  Similarity=0.277  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.+.|.+|+|||++...
T Consensus         8 ~~~I~i~G~~GsGKST~~~~   27 (203)
T 1uf9_A            8 PIIIGITGNIGSGKSTVAAL   27 (203)
T ss_dssp             CEEEEEEECTTSCHHHHHHH
T ss_pred             ceEEEEECCCCCCHHHHHHH
Confidence            46789999999999999974

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=96.23  E-value=0.0022  Score=39.62  Aligned_cols=19  Identities=26%  Similarity=0.295  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+++..
T Consensus        46 ~~vli~G~~G~GKTtl~~~   64 (386)
T 2qby_A           46 NNIFIYGLTGTGKTAVVKF   64 (386)
T ss_dssp             CCEEEEECTTSSHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3578899999999999975

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*

Probab=96.22  E-value=0.0029  Score=36.47  Aligned_cols=18  Identities=39%  Similarity=0.320  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|+..
T Consensus        22 ~~~i~G~~GsGKTtl~~~   39 (220)
T 2cvh_A           22 LTQVYGPYASGKTTLALQ   39 (220)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478899999999999985

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*

Probab=96.21  E-value=0.0045  Score=37.22  Aligned_cols=20  Identities=35%  Similarity=0.474  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||+++..
T Consensus        64 ~~~vLl~G~~GtGKT~la~~   83 (272)
T 1d2n_A           64 LVSVLLEGPPHSGKTALAAK   83 (272)
T ss_dssp             EEEEEEECSTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCcHHHHHHH
Confidence            45788999999999999975

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*

Probab=96.18  E-value=0.0036  Score=37.35  Aligned_cols=19  Identities=32%  Similarity=0.265  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus        26 ~iigI~G~~GsGKSTl~k~   44 (245)
T 2jeo_A           26 FLIGVSGGTASGKSTVCEK   44 (245)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A*

Probab=96.17  E-value=0.0025  Score=43.49  Aligned_cols=22  Identities=32%  Similarity=0.395  Sum_probs=19.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++.++|++|+|||||+.+
T Consensus         7 ~~~~~i~IiG~~gaGKTTLl~~   28 (665)
T 2dy1_A            7 AMIRTVALVGHAGSGKTTLTEA   28 (665)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHH
T ss_pred             CCCcEEEEECCCCChHHHHHHH
Confidence            4467999999999999999986

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A

Probab=96.17  E-value=0.003  Score=40.21  Aligned_cols=18  Identities=44%  Similarity=0.554  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.||+|+|||+|..+
T Consensus         5 ~i~i~GptgsGKt~la~~   22 (322)
T 3exa_A            5 LVAIVGPTAVGKTKTSVM   22 (322)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCcCCHHHHHHH
Confidence            467899999999999986

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*

Probab=96.16  E-value=0.0031  Score=38.29  Aligned_cols=20  Identities=20%  Similarity=0.333  Sum_probs=17.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||+++..
T Consensus        67 ~~~vll~G~~GtGKT~la~~   86 (309)
T 3syl_A           67 TLHMSFTGNPGTGKTTVALK   86 (309)
T ss_dssp             CCEEEEEECTTSSHHHHHHH
T ss_pred             CceEEEECCCCCCHHHHHHH
Confidence            34689999999999999964

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}

Probab=96.15  E-value=0.0031  Score=40.05  Aligned_cols=19  Identities=47%  Similarity=0.555  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+|+..
T Consensus       176 ~~i~ivG~sGsGKSTll~~  194 (361)
T 2gza_A          176 RVIVVAGETGSGKTTLMKA  194 (361)
T ss_dssp             CCEEEEESSSSCHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3688999999999999974

>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A*

Probab=96.15  E-value=0.01  Score=41.62  Aligned_cols=22  Identities=18%  Similarity=0.261  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++++|+.++|||||+.+
T Consensus        17 ~~~rnI~IiG~~~~GKTTL~~~   38 (842)
T 1n0u_A           17 TNVRNMSVIAHVDHGKSTLTDS   38 (842)
T ss_dssp             GGEEEEEEECCGGGTHHHHHHH
T ss_pred             ccccEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999996

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*

Probab=96.15  E-value=0.0081  Score=35.63  Aligned_cols=22  Identities=32%  Similarity=0.357  Sum_probs=19.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+++.|..|||||+++.+
T Consensus        12 ~~~~i~~~~GkgGvGKTTl~~~   33 (262)
T 1yrb_A           12 MASMIVVFVGTAGSGKTTLTGE   33 (262)
T ss_dssp             CCCEEEEEECSTTSSHHHHHHH
T ss_pred             cceEEEEEeCCCCCCHHHHHHH
Confidence            4457788999999999999986

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20

Probab=96.14  E-value=0.0021  Score=39.31  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.|+|||+|+..
T Consensus        32 ~v~i~G~~G~GKT~L~~~   49 (357)
T 2fna_A           32 ITLVLGLRRTGKSSIIKI   49 (357)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            578899999999999985

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}

Probab=96.14  E-value=0.0036  Score=38.96  Aligned_cols=19  Identities=32%  Similarity=0.506  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus       153 ~~lll~G~~GtGKT~La~a  171 (308)
T 2qgz_A          153 KGLYLYGDMGIGKSYLLAA  171 (308)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            5789999999999999874

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}

Probab=96.13  E-value=0.0039  Score=37.48  Aligned_cols=21  Identities=19%  Similarity=0.328  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|++|+|||++...
T Consensus        31 ~~~~i~l~G~~GsGKSTla~~   51 (253)
T 2p5t_B           31 QPIAILLGGQSGAGKTTIHRI   51 (253)
T ss_dssp             SCEEEEEESCGGGTTHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            346789999999999999975

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*

Probab=96.13  E-value=0.0029  Score=35.56  Aligned_cols=17  Identities=29%  Similarity=0.604  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .+++|++|+|||+++..
T Consensus        26 ~~I~G~NGsGKStil~A   42 (149)
T 1f2t_A           26 NLIIGQNGSGKSSLLDA   42 (149)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            46789999999999875

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1

Probab=96.13  E-value=0.0047  Score=34.85  Aligned_cols=19  Identities=21%  Similarity=0.326  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|..|+|||++..+
T Consensus         4 ~~I~l~G~~GsGKsT~a~~   22 (196)
T 1tev_A            4 LVVFVLGGPGAGKGTQCAR   22 (196)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4689999999999999874

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20

Probab=96.12  E-value=0.0034  Score=38.96  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        46 ~~li~G~~G~GKTtl~~~   63 (389)
T 1fnn_A           46 RATLLGRPGTGKTVTLRK   63 (389)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999975

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*

Probab=96.11  E-value=0.0043  Score=35.69  Aligned_cols=20  Identities=20%  Similarity=-0.067  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|++.|..|+|||++...
T Consensus        10 ~~~I~l~G~~GsGKST~~~~   29 (212)
T 2wwf_A           10 GKFIVFEGLDRSGKSTQSKL   29 (212)
T ss_dssp             SCEEEEEESTTSSHHHHHHH
T ss_pred             CCEEEEEcCCCCCHHHHHHH
Confidence            35789999999999999975

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*

Probab=96.11  E-value=0.004  Score=36.39  Aligned_cols=19  Identities=21%  Similarity=0.396  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||++..+
T Consensus         5 ~~I~l~G~~GsGKsT~a~~   23 (220)
T 1aky_A            5 IRMVLIGPPGAGKGTQAPN   23 (220)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5799999999999999875

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A

Probab=96.09  E-value=0.0034  Score=42.08  Aligned_cols=19  Identities=37%  Similarity=0.433  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus       294 eVI~LVGpNGSGKTTLl~~  312 (503)
T 2yhs_A          294 FVILMVGVNGVGKTTTIGK  312 (503)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEECCCcccHHHHHHH
Confidence            4678999999999999975

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}

Probab=96.09  E-value=0.0035  Score=38.63  Aligned_cols=18  Identities=28%  Similarity=0.407  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        57 ~vll~G~~GtGKT~la~~   74 (338)
T 3pfi_A           57 HILFSGPAGLGKTTLANI   74 (338)
T ss_dssp             CEEEECSTTSSHHHHHHH
T ss_pred             eEEEECcCCCCHHHHHHH
Confidence            589999999999999975

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*

Probab=96.08  E-value=0.0052  Score=37.27  Aligned_cols=19  Identities=37%  Similarity=0.452  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        48 ~~~ll~G~~GtGKt~la~~   66 (311)
T 4fcw_A           48 GSFLFLGPTGVGKTELAKT   66 (311)
T ss_dssp             EEEEEESCSSSSHHHHHHH
T ss_pred             eEEEEECCCCcCHHHHHHH
Confidence            4689999999999999974

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*

Probab=96.08  E-value=0.0032  Score=37.02  Aligned_cols=19  Identities=21%  Similarity=0.475  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||+++.+
T Consensus         8 ~~I~l~G~~GsGKsT~a~~   26 (227)
T 1zd8_A            8 LRAVIMGAPGSGKGTVSSR   26 (227)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5799999999999999975

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*

Probab=96.08  E-value=0.0043  Score=35.47  Aligned_cols=19  Identities=26%  Similarity=0.141  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|..|+|||++...
T Consensus         5 ~~I~l~G~~GsGKsT~~~~   23 (204)
T 2v54_A            5 ALIVFEGLDKSGKTTQCMN   23 (204)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEEcCCCCCHHHHHHH
Confidence            4789999999999999975

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A

Probab=96.07  E-value=0.0028  Score=38.98  Aligned_cols=19  Identities=16%  Similarity=0.045  Sum_probs=15.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        37 ~~lLl~GppGtGKT~la~a   55 (293)
T 3t15_A           37 LILGIWGGKGQGKSFQCEL   55 (293)
T ss_dssp             SEEEEEECTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3567779999999999975

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A

Probab=96.07  E-value=0.0049  Score=38.78  Aligned_cols=18  Identities=39%  Similarity=0.564  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus       173 ~v~i~G~~GsGKTTll~~  190 (330)
T 2pt7_A          173 NVIVCGGTGSGKTTYIKS  190 (330)
T ss_dssp             CEEEEESTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A

Probab=96.07  E-value=0.0045  Score=40.45  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=19.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|..++|||||+.+
T Consensus         6 ~~~~i~iiG~~~~GKSTLi~~   26 (458)
T 1f60_A            6 SHINVVVIGHVDSGKSTTTGH   26 (458)
T ss_dssp             EEEEEEEEECTTSCHHHHHHH
T ss_pred             ceeEEEEEcCCCCCHHHHHHH
Confidence            568999999999999999996

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10

Probab=96.07  E-value=0.003  Score=39.58  Aligned_cols=19  Identities=32%  Similarity=0.298  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus       105 ~vi~ivG~~GsGKTTl~~~  123 (306)
T 1vma_A          105 FVIMVVGVNGTGKTTSCGK  123 (306)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEEcCCCChHHHHHHH
Confidence            4578999999999999986

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=96.06  E-value=0.0034  Score=38.79  Aligned_cols=17  Identities=24%  Similarity=0.311  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus        39 ~ll~Gp~G~GKTtl~~~   55 (354)
T 1sxj_E           39 LLLYGPNGTGKKTRCMA   55 (354)
T ss_dssp             EEEECSTTSSHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            89999999999999974

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}

Probab=96.06  E-value=0.0044  Score=34.46  Aligned_cols=18  Identities=17%  Similarity=0.255  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++.|..|+|||++...
T Consensus         2 ~I~l~G~~GsGKsT~a~~   19 (168)
T 2pt5_A            2 RIYLIGFMCSGKSTVGSL   19 (168)
T ss_dssp             EEEEESCTTSCHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            689999999999999874

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*

Probab=96.06  E-value=0.0027  Score=38.73  Aligned_cols=18  Identities=17%  Similarity=0.374  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|+..
T Consensus        37 ~~~i~G~~G~GKTTl~~~   54 (296)
T 1cr0_A           37 VIMVTSGSGMGKSTFVRQ   54 (296)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            467889999999999975

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}

Probab=96.06  E-value=0.0022  Score=35.46  Aligned_cols=19  Identities=5%  Similarity=0.022  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        28 ~~vll~G~~GtGKt~lA~~   46 (143)
T 3co5_A           28 SPVFLTGEAGSPFETVARY   46 (143)
T ss_dssp             SCEEEEEETTCCHHHHHGG
T ss_pred             CcEEEECCCCccHHHHHHH
Confidence            3588999999999999974

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}

Probab=96.06  E-value=0.0034  Score=38.62  Aligned_cols=19  Identities=32%  Similarity=0.307  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        50 ~~vLL~Gp~GtGKT~la~a   68 (301)
T 3cf0_A           50 KGVLFYGPPGCGKTLLAKA   68 (301)
T ss_dssp             SEEEEECSSSSSHHHHHHH
T ss_pred             ceEEEECCCCcCHHHHHHH
Confidence            3588999999999999974

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*

Probab=96.05  E-value=0.0033  Score=36.66  Aligned_cols=18  Identities=17%  Similarity=0.303  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++.|..|+|||++...
T Consensus         2 ~I~l~G~~GsGKsT~a~~   19 (214)
T 1e4v_A            2 RIILLGAPVAGKGTQAQF   19 (214)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            689999999999999875

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*

Probab=96.05  E-value=0.0038  Score=37.55  Aligned_cols=19  Identities=26%  Similarity=0.534  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        35 ~~ilI~GpsGsGKStLA~~   53 (205)
T 2qmh_A           35 LGVLITGDSGVGKSETALE   53 (205)
T ss_dssp             EEEEEECCCTTTTHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            3578999999999999986

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A

Probab=96.04  E-value=0.0047  Score=40.31  Aligned_cols=21  Identities=33%  Similarity=0.181  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|+++|..|+|||++..+
T Consensus        38 ~~~~IvlvGlpGsGKSTia~~   58 (469)
T 1bif_A           38 CPTLIVMVGLPARGKTYISKK   58 (469)
T ss_dssp             CCEEEEEECCTTSSHHHHHHH
T ss_pred             CcEEEEEECCCCCCHHHHHHH
Confidence            356899999999999999986

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}

Probab=96.04  E-value=0.0028  Score=39.21  Aligned_cols=19  Identities=26%  Similarity=0.312  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+++..
T Consensus        45 ~~vll~G~~G~GKT~l~~~   63 (387)
T 2v1u_A           45 SNALLYGLTGTGKTAVARL   63 (387)
T ss_dssp             CCEEECBCTTSSHHHHHHH
T ss_pred             CcEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8

Probab=96.04  E-value=0.0011  Score=41.66  Aligned_cols=19  Identities=37%  Similarity=0.578  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||||+..
T Consensus       174 ~~~~lvG~sG~GKSTLln~  192 (307)
T 1t9h_A          174 KTTVFAGQSGVGKSSLLNA  192 (307)
T ss_dssp             SEEEEEESHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3678999999999999985

>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli}

Probab=96.03  E-value=0.0018  Score=43.15  Aligned_cols=21  Identities=24%  Similarity=0.300  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|+.++|||||+.+
T Consensus         3 R~~~V~IvGhvd~GKTTLl~~   23 (501)
T 1zo1_I            3 RAPVVTIMGHVDHGKTSLLEY   23 (501)
T ss_dssp             CCCCEEEEESTTSSSHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            346899999999999999986

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*

Probab=96.03  E-value=0.0044  Score=39.07  Aligned_cols=20  Identities=30%  Similarity=0.419  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+|+..
T Consensus        55 g~~v~i~G~~GaGKSTLl~~   74 (337)
T 2qm8_A           55 AIRVGITGVPGVGKSTTIDA   74 (337)
T ss_dssp             SEEEEEECCTTSCHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            35688999999999999985

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*

Probab=96.02  E-value=0.0034  Score=40.92  Aligned_cols=19  Identities=32%  Similarity=0.585  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+|+..
T Consensus        70 ~~valvG~nGaGKSTLln~   88 (413)
T 1tq4_A           70 LNVAVTGETGSGKSSFINT   88 (413)
T ss_dssp             EEEEEEECTTSSHHHHHHH
T ss_pred             eEEEEECCCCCcHHHHHHH
Confidence            4788999999999999974

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*

Probab=96.02  E-value=0.0045  Score=36.66  Aligned_cols=18  Identities=22%  Similarity=0.206  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|+.|+||++...+
T Consensus         2 ~Iil~GpPGsGKgTqa~~   19 (206)
T 3sr0_A            2 ILVFLGPPGAGKGTQAKR   19 (206)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999998875

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}

Probab=96.02  E-value=0.0048  Score=39.44  Aligned_cols=19  Identities=47%  Similarity=0.534  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||++..+
T Consensus         8 ~lI~I~GptgSGKTtla~~   26 (340)
T 3d3q_A            8 FLIVIVGPTASGKTELSIE   26 (340)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEECCCcCcHHHHHHH
Confidence            4688999999999999975

>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana}

Probab=96.01  E-value=0.0075  Score=38.49  Aligned_cols=23  Identities=17%  Similarity=0.307  Sum_probs=20.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....|++++|.+++|||+++.+
T Consensus         6 ~~~~~k~lllG~~~sGKsT~~kq   28 (354)
T 2xtz_A            6 GIHIRKLLLLGAGESGKSTIFKQ   28 (354)
T ss_dssp             CCEEEEEEEECSTTSSHHHHHHH
T ss_pred             CCCceeEEEECCCCCcHHHHHHH
Confidence            45678999999999999999986

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}

Probab=96.00  E-value=0.0056  Score=37.25  Aligned_cols=21  Identities=24%  Similarity=0.238  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+|+++.|.+|||||+++.+
T Consensus         5 g~l~I~~~~kgGvGKTt~a~~   25 (228)
T 2r8r_A            5 GRLKVFLGAAPGVGKTYAMLQ   25 (228)
T ss_dssp             CCEEEEEESSTTSSHHHHHHH
T ss_pred             ceEEEEEECCCCCcHHHHHHH
Confidence            358999999999999999765

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*

Probab=96.00  E-value=0.0043  Score=37.15  Aligned_cols=19  Identities=16%  Similarity=0.427  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        30 ~~vll~G~~GtGKt~la~~   48 (265)
T 2bjv_A           30 KPVLIIGERGTGKELIASR   48 (265)
T ss_dssp             SCEEEECCTTSCHHHHHHH
T ss_pred             CCEEEECCCCCcHHHHHHH
Confidence            4688999999999999974

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1

Probab=95.99  E-value=0.0029  Score=37.05  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|+.|+|||++..+
T Consensus         6 ~~I~l~G~~GsGKsT~~~~   24 (222)
T 1zak_A            6 LKVMISGAPASGKGTQCEL   24 (222)
T ss_dssp             CCEEEEESTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4689999999999999875

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A

Probab=95.99  E-value=0.0057  Score=38.86  Aligned_cols=19  Identities=37%  Similarity=0.420  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|++|+|||+|..+
T Consensus        11 ~~i~i~GptgsGKt~la~~   29 (316)
T 3foz_A           11 KAIFLMGPTASGKTALAIE   29 (316)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             cEEEEECCCccCHHHHHHH
Confidence            3467899999999999986

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10

Probab=95.98  E-value=0.0047  Score=35.82  Aligned_cols=19  Identities=37%  Similarity=0.312  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|.+|+|||+++.+
T Consensus         5 ~~i~i~G~sGsGKTTl~~~   23 (169)
T 1xjc_A            5 NVWQVVGYKHSGKTTLMEK   23 (169)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            3578999999999999986

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*

Probab=95.98  E-value=0.0049  Score=36.33  Aligned_cols=18  Identities=17%  Similarity=0.187  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|..|+|||++..+
T Consensus         2 ~I~l~G~~GsGKsT~a~~   19 (223)
T 2xb4_A            2 NILIFGPNGSGKGTQGNL   19 (223)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            588999999999999975

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}

Probab=95.96  E-value=0.003  Score=41.60  Aligned_cols=17  Identities=41%  Similarity=0.642  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus       140 ~v~IvGpnGsGKSTLlr  156 (460)
T 2npi_A          140 RVVIVGGSQTGKTSLSR  156 (460)
T ss_dssp             CEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999997

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20

Probab=95.95  E-value=0.0045  Score=38.96  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        73 ~~ill~Gp~GtGKT~la~~   91 (376)
T 1um8_A           73 SNILLIGPTGSGKTLMAQT   91 (376)
T ss_dssp             CCEEEECCTTSSHHHHHHH
T ss_pred             CCEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*

Probab=95.94  E-value=0.0036  Score=39.77  Aligned_cols=18  Identities=22%  Similarity=0.422  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+..
T Consensus        73 ~~gIiG~nGaGKTTLl~~   90 (347)
T 2obl_A           73 RIGIFAGSGVGKSTLLGM   90 (347)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            678999999999999863

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A

Probab=95.94  E-value=0.0041  Score=41.63  Aligned_cols=17  Identities=35%  Similarity=0.458  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus       369 ~~~ivG~sGsGKSTll~  385 (578)
T 4a82_A          369 TVAFVGMSGGGKSTLIN  385 (578)
T ss_dssp             EEEEECSTTSSHHHHHT
T ss_pred             EEEEECCCCChHHHHHH
Confidence            47799999999999997

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}

Probab=95.94  E-value=0.0065  Score=35.56  Aligned_cols=29  Identities=24%  Similarity=0.286  Sum_probs=19.5

Q ss_pred             CCCCCCCceeeEEEEECCCCChHHHHHhH
Q psy15257          3 SDNEQPHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         3 ~~~~~~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++-......+.+.+.|..|+|||++...
T Consensus         3 ~~~~~~~~~~~iIgltG~~GSGKSTva~~   31 (192)
T 2grj_A            3 SDKIHHHHHHMVIGVTGKIGTGKSTVCEI   31 (192)
T ss_dssp             -------CCEEEEEEECSTTSSHHHHHHH
T ss_pred             cccccccccceEEEEECCCCCCHHHHHHH
Confidence            33444455678899999999999999974

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}

Probab=95.93  E-value=0.0043  Score=41.53  Aligned_cols=18  Identities=22%  Similarity=0.423  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       371 ~~~ivG~sGsGKSTll~~  388 (582)
T 3b5x_A          371 TVALVGRSGSGKSTIANL  388 (582)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*

Probab=95.92  E-value=0.0051  Score=34.28  Aligned_cols=18  Identities=22%  Similarity=0.235  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|..|+|||++...
T Consensus         4 ~I~l~G~~GsGKsT~a~~   21 (173)
T 1e6c_A            4 PIFMVGARGCGMTTVGRE   21 (173)
T ss_dssp             CEEEESCTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999875

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A

Probab=95.92  E-value=0.0035  Score=41.18  Aligned_cols=20  Identities=25%  Similarity=0.205  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|++|+|||+++.+
T Consensus        97 ~~vI~lvG~~GsGKTTt~~k  116 (433)
T 3kl4_A           97 PFIIMLVGVQGSGKTTTAGK  116 (433)
T ss_dssp             SEEEEECCCTTSCHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            45688899999999999986

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}

Probab=95.92  E-value=0.0037  Score=40.90  Aligned_cols=18  Identities=22%  Similarity=0.368  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       159 ~~~IvG~sGsGKSTLl~~  176 (438)
T 2dpy_A          159 RMGLFAGSGVGKSVLLGM  176 (438)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            678999999999999863

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6

Probab=95.91  E-value=0.0046  Score=35.84  Aligned_cols=20  Identities=25%  Similarity=0.154  Sum_probs=17.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++..
T Consensus        22 ~~~i~i~G~~GsGKstl~~~   41 (201)
T 1rz3_A           22 RLVLGIDGLSRSGKTTLANQ   41 (201)
T ss_dssp             SEEEEEEECTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            35788999999999999874

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*

Probab=95.91  E-value=0.0036  Score=38.88  Aligned_cols=19  Identities=21%  Similarity=0.422  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        71 ~~vLl~GppGtGKT~la~~   89 (368)
T 3uk6_A           71 RAVLIAGQPGTGKTAIAMG   89 (368)
T ss_dssp             CEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3688999999999999975

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B

Probab=95.91  E-value=0.0026  Score=43.04  Aligned_cols=18  Identities=33%  Similarity=0.586  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||||+..
T Consensus        47 ~iaIvG~nGsGKSTLL~~   64 (608)
T 3szr_A           47 AIAVIGDQSSGKSSVLEA   64 (608)
T ss_dssp             CEECCCCTTSCHHHHHHH
T ss_pred             eEEEECCCCChHHHHHHH
Confidence            489999999999999974

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*

Probab=95.90  E-value=0.006  Score=34.34  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||++...
T Consensus         7 ~~I~l~G~~GsGKsT~~~~   25 (194)
T 1qf9_A            7 NVVFVLGGPGSGKGTQCAN   25 (194)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4689999999999999874

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A

Probab=95.90  E-value=0.0037  Score=41.83  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       371 ~~~ivG~sGsGKSTLl~~  388 (582)
T 3b60_A          371 TVALVGRSGSGKSTIASL  388 (582)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*

Probab=95.90  E-value=0.0043  Score=40.45  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus       169 ii~I~GpnGSGKTTlL~a  186 (418)
T 1p9r_A          169 IILVTGPTGSGKSTTLYA  186 (418)
T ss_dssp             EEEEECSTTSCHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999975

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}

Probab=95.89  E-value=0.0045  Score=40.50  Aligned_cols=19  Identities=32%  Similarity=0.497  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|||||+++..
T Consensus       202 ~~~LL~G~pG~GKT~la~~  220 (468)
T 3pxg_A          202 NNPVLIGEPGVGKTAIAEG  220 (468)
T ss_dssp             CEEEEESCTTTTTHHHHHH
T ss_pred             CCeEEECCCCCCHHHHHHH
Confidence            3678999999999999975

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=95.89  E-value=0.0049  Score=41.18  Aligned_cols=18  Identities=22%  Similarity=0.331  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        49 ~~~LvG~NGaGKSTLlk~   66 (538)
T 1yqt_A           49 VVGIVGPNGTGKSTAVKI   66 (538)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C

Probab=95.89  E-value=0.0047  Score=38.27  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        52 ~~vLl~GppGtGKT~la~a   70 (322)
T 3eie_A           52 SGILLYGPPGTGKSYLAKA   70 (322)
T ss_dssp             CEEEEECSSSSCHHHHHHH
T ss_pred             CeEEEECCCCCcHHHHHHH
Confidence            4689999999999999975

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A

Probab=95.88  E-value=0.0063  Score=38.61  Aligned_cols=19  Identities=42%  Similarity=0.489  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||++..+
T Consensus         6 ~~i~i~GptGsGKTtla~~   24 (323)
T 3crm_A            6 PAIFLMGPTAAGKTDLAMA   24 (323)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3688999999999999975

>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei}

Probab=95.88  E-value=0.0034  Score=40.10  Aligned_cols=18  Identities=22%  Similarity=0.505  Sum_probs=17.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|..++|||||+.+
T Consensus        23 ~i~iiG~~d~GKSTL~~~   40 (370)
T 2elf_A           23 NVAIIGTEKSGRTSLAAN   40 (370)
T ss_dssp             EEEEEESTTSSHHHHHHT
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            899999999999999996

>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus}

Probab=95.88  E-value=0.0054  Score=42.11  Aligned_cols=23  Identities=13%  Similarity=0.082  Sum_probs=20.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+++++|..++|||||+.+
T Consensus         7 ~~~~~~I~IvG~~~aGKSTL~~~   29 (693)
T 2xex_A            7 LEKTRNIGIMAHIDAGKTTTTER   29 (693)
T ss_dssp             STTEEEEEEECCGGGTHHHHHHH
T ss_pred             cccceEEEEECCCCCCHHHHHHH
Confidence            34568999999999999999986

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*

Probab=95.88  E-value=0.0054  Score=38.01  Aligned_cols=20  Identities=25%  Similarity=0.258  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++..
T Consensus        80 g~iigI~G~~GsGKSTl~~~   99 (308)
T 1sq5_A           80 PYIISIAGSVAVGKSTTARV   99 (308)
T ss_dssp             CEEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            35688999999999999974

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*

Probab=95.87  E-value=0.0065  Score=36.37  Aligned_cols=21  Identities=33%  Similarity=0.316  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.|.+.|++|+|||++...
T Consensus        21 ~~~iI~I~G~~GSGKST~a~~   41 (252)
T 1uj2_A           21 EPFLIGVSGGTASGKSSVCAK   41 (252)
T ss_dssp             CCEEEEEECSTTSSHHHHHHH
T ss_pred             CcEEEEEECCCCCCHHHHHHH
Confidence            346799999999999999874

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1

Probab=95.86  E-value=0.0058  Score=40.70  Aligned_cols=18  Identities=50%  Similarity=0.702  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus       262 ~i~I~GptGSGKTTlL~a  279 (511)
T 2oap_1          262 SAIVVGETASGKTTTLNA  279 (511)
T ss_dssp             CEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            488999999999999974

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*

Probab=95.86  E-value=0.0061  Score=36.02  Aligned_cols=20  Identities=25%  Similarity=0.308  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|++.|..|+|||++..+
T Consensus        16 ~~~I~l~G~~GsGKsT~a~~   35 (233)
T 1ak2_A           16 GVRAVLLGPPGAGKGTQAPK   35 (233)
T ss_dssp             CCEEEEECCTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            36799999999999999875

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}

Probab=95.86  E-value=0.0043  Score=36.30  Aligned_cols=18  Identities=22%  Similarity=0.292  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++.+
T Consensus        25 ~~~i~G~~GsGKTtl~~~   42 (247)
T 2dr3_A           25 VVLLSGGPGTGKTIFSQQ   42 (247)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467889999999999875

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*

Probab=95.85  E-value=0.0045  Score=38.47  Aligned_cols=19  Identities=32%  Similarity=0.427  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus       106 ~vi~lvG~~GsGKTTl~~~  124 (296)
T 2px0_A          106 KYIVLFGSTGAGKTTTLAK  124 (296)
T ss_dssp             SEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4678899999999999985

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A

Probab=95.85  E-value=0.005  Score=34.93  Aligned_cols=19  Identities=26%  Similarity=0.181  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||++...
T Consensus        10 ~~I~l~G~~GsGKsT~~~~   28 (196)
T 2c95_A           10 NIIFVVGGPGSGKGTQCEK   28 (196)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=95.85  E-value=0.0041  Score=38.66  Aligned_cols=18  Identities=28%  Similarity=0.219  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++..
T Consensus        47 ~vll~G~~G~GKT~la~~   64 (384)
T 2qby_B           47 SNLFLGLTGTGKTFVSKY   64 (384)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            688999999999999975

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}

Probab=95.83  E-value=0.0049  Score=35.04  Aligned_cols=19  Identities=16%  Similarity=0.179  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||++...
T Consensus        13 ~~I~l~G~~GsGKsT~a~~   31 (199)
T 2bwj_A           13 KIIFIIGGPGSGKGTQCEK   31 (199)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4689999999999999874

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}

Probab=95.83  E-value=0.0046  Score=37.70  Aligned_cols=19  Identities=26%  Similarity=0.170  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||++...
T Consensus        49 ~~i~l~G~~GsGKSTl~~~   67 (250)
T 3nwj_A           49 RSMYLVGMMGSGKTTVGKI   67 (250)
T ss_dssp             CCEEEECSTTSCHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4689999999999999874

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A

Probab=95.83  E-value=0.0054  Score=38.46  Aligned_cols=20  Identities=30%  Similarity=0.370  Sum_probs=17.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||+++..
T Consensus        51 ~~~vll~GppGtGKT~la~~   70 (363)
T 3hws_A           51 KSNILLIGPTGSGKTLLAET   70 (363)
T ss_dssp             CCCEEEECCTTSSHHHHHHH
T ss_pred             CCeEEEECCCCCCHHHHHHH
Confidence            34689999999999999974

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*

Probab=95.82  E-value=0.0048  Score=39.25  Aligned_cols=17  Identities=41%  Similarity=0.528  Sum_probs=14.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .+++|++|+|||+|+-.
T Consensus        26 ~~i~G~NGaGKTTll~a   42 (365)
T 3qf7_A           26 TVVEGPNGAGKSSLFEA   42 (365)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            45789999999999864

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*

Probab=95.82  E-value=0.0016  Score=37.61  Aligned_cols=18  Identities=22%  Similarity=0.289  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|.+|+|||+++.+
T Consensus         2 ~I~i~G~~GsGKsTl~~~   19 (214)
T 1gtv_A            2 LIAIEGVDGAGKRTLVEK   19 (214)
T ss_dssp             EEEEEEEEEEEHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            478899999999999975

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*

Probab=95.81  E-value=0.0073  Score=34.12  Aligned_cols=19  Identities=26%  Similarity=0.310  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||+++..
T Consensus         6 ~~i~l~G~~GsGKST~~~~   24 (179)
T 2pez_A            6 CTVWLTGLSGAGKTTVSMA   24 (179)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4688999999999999874

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.81  E-value=0.0056  Score=37.64  Aligned_cols=17  Identities=35%  Similarity=0.434  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus        61 ~ll~G~~G~GKT~la~~   77 (353)
T 1sxj_D           61 MLFYGPPGTGKTSTILA   77 (353)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            88999999999999974

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}

Probab=95.80  E-value=0.0066  Score=34.26  Aligned_cols=18  Identities=22%  Similarity=0.075  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|..|+|||++...
T Consensus         2 ~I~l~G~~GsGKsT~~~~   19 (195)
T 2pbr_A            2 LIAFEGIDGSGKTTQAKK   19 (195)
T ss_dssp             EEEEECSTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.79  E-value=0.0051  Score=38.20  Aligned_cols=17  Identities=35%  Similarity=0.452  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.||+|+|||+++..
T Consensus        49 ~ll~Gp~G~GKTtla~~   65 (340)
T 1sxj_C           49 LLFYGPPGTGKTSTIVA   65 (340)
T ss_dssp             EEEECSSSSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78899999999999974

>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W*

Probab=95.78  E-value=0.0043  Score=41.43  Aligned_cols=22  Identities=14%  Similarity=0.214  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++++|+.++|||||+.+
T Consensus        11 ~~~~~I~IiG~~~aGKTTL~~~   32 (529)
T 2h5e_A           11 AKRRTFAIISHPDAGKTTITEK   32 (529)
T ss_dssp             HTEEEEEEEECTTSSHHHHHHH
T ss_pred             cCCCEEEEECCCCChHHHHHHH
Confidence            4568999999999999999996

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*

Probab=95.78  E-value=0.0099  Score=39.36  Aligned_cols=19  Identities=16%  Similarity=0.226  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+.++|.+|+|||+|+..
T Consensus       153 ~vv~I~G~gGvGKTtLA~~  171 (549)
T 2a5y_B          153 FFLFLHGRAGSGKSVIASQ  171 (549)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             eEEEEEcCCCCCHHHHHHH
Confidence            4578899999999999985

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*

Probab=95.77  E-value=0.0036  Score=38.20  Aligned_cols=19  Identities=26%  Similarity=0.410  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        39 ~~vll~G~~GtGKT~la~~   57 (324)
T 1hqc_A           39 EHLLLFGPPGLGKTTLAHV   57 (324)
T ss_dssp             CCCEEECCTTCCCHHHHHH
T ss_pred             CcEEEECCCCCCHHHHHHH
Confidence            3588999999999999975

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*

Probab=95.76  E-value=0.0053  Score=40.84  Aligned_cols=18  Identities=17%  Similarity=0.366  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~liG~nGsGKSTLl~~   48 (483)
T 3euj_A           31 VTTLSGGNGAGKSTTMAG   48 (483)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            467899999999999973

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}

Probab=95.76  E-value=0.0055  Score=38.18  Aligned_cols=19  Identities=26%  Similarity=0.323  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        46 ~~iLL~GppGtGKT~la~a   64 (322)
T 1xwi_A           46 RGILLFGPPGTGKSYLAKA   64 (322)
T ss_dssp             SEEEEESSSSSCHHHHHHH
T ss_pred             ceEEEECCCCccHHHHHHH
Confidence            4688999999999999975

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=95.76  E-value=0.0056  Score=41.14  Aligned_cols=18  Identities=33%  Similarity=0.540  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       371 ~~~ivG~sGsGKSTll~~  388 (587)
T 3qf4_A          371 LVAVLGETGSGKSTLMNL  388 (587)
T ss_dssp             EEEEECSSSSSHHHHHHT
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=95.74  E-value=0.0049  Score=41.47  Aligned_cols=18  Identities=39%  Similarity=0.582  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       383 ~~~ivG~sGsGKSTll~~  400 (598)
T 3qf4_B          383 KVALVGPTGSGKTTIVNL  400 (598)
T ss_dssp             EEEEECCTTSSTTHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            578999999999999973

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}

Probab=95.73  E-value=0.0047  Score=38.07  Aligned_cols=18  Identities=17%  Similarity=0.207  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        48 ~vll~G~pGtGKT~la~~   65 (331)
T 2r44_A           48 HILLEGVPGLAKTLSVNT   65 (331)
T ss_dssp             CEEEESCCCHHHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            588999999999999975

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*

Probab=95.73  E-value=0.0022  Score=38.38  Aligned_cols=18  Identities=39%  Similarity=0.469  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        46 ~vll~G~~GtGKT~la~~   63 (268)
T 2r62_A           46 GVLLVGPPGTGKTLLAKA   63 (268)
T ss_dssp             CCCCBCSSCSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            378899999999999975

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*

Probab=95.73  E-value=0.0071  Score=36.66  Aligned_cols=20  Identities=20%  Similarity=0.252  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.+.+.|++|+|||++...
T Consensus         9 ~~~i~i~G~~GsGKsTla~~   28 (233)
T 3r20_A            9 SLVVAVDGPAGTGKSSVSRG   28 (233)
T ss_dssp             CCEEEEECCTTSSHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            46799999999999999974

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*

Probab=95.72  E-value=0.0069  Score=34.25  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++.|.+|+|||++...
T Consensus         4 ~I~l~G~~GsGKsT~a~~   21 (184)
T 2iyv_A            4 KAVLVGLPGSGKSTIGRR   21 (184)
T ss_dssp             SEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999874

>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A*

Probab=95.72  E-value=0.0088  Score=37.91  Aligned_cols=22  Identities=23%  Similarity=0.404  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++++|.+.+|||+++.+
T Consensus         5 ~~~~klLlLG~geSGKSTi~KQ   26 (327)
T 3ohm_A            5 RRELKLLLLGTGESGKSTFIKQ   26 (327)
T ss_dssp             CCEEEEEEECSTTSSHHHHHHH
T ss_pred             cccceEEEEcCCCccHHHHHHH
Confidence            4578999999999999999986

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*

Probab=95.71  E-value=0.0084  Score=36.17  Aligned_cols=19  Identities=21%  Similarity=0.319  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|.+|+|||+++..
T Consensus         5 ~lIvl~G~pGSGKSTla~~   23 (260)
T 3a4m_A            5 MLIILTGLPGVGKSTFSKN   23 (260)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             EEEEEEcCCCCCHHHHHHH
Confidence            4689999999999999975

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*

Probab=95.71  E-value=0.0055  Score=39.80  Aligned_cols=18  Identities=28%  Similarity=0.508  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|+..
T Consensus       132 ~lll~Gp~G~GKTtLa~a  149 (440)
T 2z4s_A          132 PLFIYGGVGLGKTHLLQS  149 (440)
T ss_dssp             CEEEECSSSSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999974

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}

Probab=95.68  E-value=0.0064  Score=38.31  Aligned_cols=19  Identities=21%  Similarity=0.219  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus       118 ~~vLl~GppGtGKT~la~a  136 (357)
T 3d8b_A          118 KGILLFGPPGTGKTLIGKC  136 (357)
T ss_dssp             SEEEEESSTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A

Probab=95.68  E-value=0.0046  Score=37.47  Aligned_cols=18  Identities=22%  Similarity=0.222  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|++|+|||+|+..
T Consensus        32 i~~i~G~~GsGKTtl~~~   49 (279)
T 1nlf_A           32 VGALVSPGGAGKSMLALQ   49 (279)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467889999999999975

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*

Probab=95.67  E-value=0.0072  Score=35.15  Aligned_cols=19  Identities=26%  Similarity=0.349  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||+++..
T Consensus        26 ~~i~~~G~~GsGKsT~~~~   44 (211)
T 1m7g_A           26 LTIWLTGLSASGKSTLAVE   44 (211)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4688899999999999974

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A

Probab=95.65  E-value=0.0058  Score=40.76  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus       110 ~vll~Gp~GtGKTtlar~  127 (543)
T 3m6a_A          110 ILCLAGPPGVGKTSLAKS  127 (543)
T ss_dssp             EEEEESSSSSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*

Probab=95.64  E-value=0.0062  Score=35.00  Aligned_cols=19  Identities=21%  Similarity=0.151  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++.|..|+|||+++..
T Consensus        10 ~~I~l~G~~GsGKsT~~~~   28 (215)
T 1nn5_A           10 ALIVLEGVDRAGKSTQSRK   28 (215)
T ss_dssp             CEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5789999999999999975

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A

Probab=95.64  E-value=0.0074  Score=36.68  Aligned_cols=19  Identities=16%  Similarity=0.184  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|.+|+|||++..+
T Consensus         3 ~~I~l~G~~GsGKST~a~~   21 (301)
T 1ltq_A            3 KIILTIGCPGSGKSTWARE   21 (301)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3588999999999999985

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A

Probab=95.62  E-value=0.0098  Score=34.58  Aligned_cols=19  Identities=21%  Similarity=0.300  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.+.+.|.+|+|||+++..
T Consensus         5 ~~I~i~G~~GSGKST~~~~   23 (218)
T 1vht_A            5 YIVALTGGIGSGKSTVANA   23 (218)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5789999999999999974

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}

Probab=95.62  E-value=0.0064  Score=40.08  Aligned_cols=20  Identities=25%  Similarity=0.288  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|.+|+|||+++.+
T Consensus       100 p~vIlivG~~G~GKTTt~~k  119 (443)
T 3dm5_A          100 PTILLMVGIQGSGKTTTVAK  119 (443)
T ss_dssp             SEEEEEECCTTSSHHHHHHH
T ss_pred             CeEEEEECcCCCCHHHHHHH
Confidence            46789999999999999886

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}

Probab=95.62  E-value=0.0054  Score=34.50  Aligned_cols=19  Identities=26%  Similarity=0.195  Sum_probs=12.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|..|+|||++...
T Consensus         6 ~~I~l~G~~GsGKST~a~~   24 (183)
T 2vli_A            6 PIIWINGPFGVGKTHTAHT   24 (183)
T ss_dssp             CEEEEECCC----CHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*

Probab=95.60  E-value=0.0063  Score=35.67  Aligned_cols=17  Identities=29%  Similarity=0.604  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .+++|++|+|||+++..
T Consensus        26 ~~I~G~NgsGKStil~a   42 (203)
T 3qks_A           26 NLIIGQNGSGKSSLLDA   42 (203)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            46779999999999975

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}

Probab=95.59  E-value=0.0069  Score=41.14  Aligned_cols=16  Identities=31%  Similarity=0.513  Sum_probs=14.6

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +.++|++|+|||+|+.
T Consensus       351 vaIiGpnGsGKSTLl~  366 (670)
T 3ux8_A          351 VAVTGVSGSGKSTLVN  366 (670)
T ss_dssp             EEEECSTTSSHHHHHT
T ss_pred             EEEEeeCCCCHHHHHH
Confidence            6799999999999984

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}

Probab=95.58  E-value=0.0072  Score=38.33  Aligned_cols=19  Identities=32%  Similarity=0.296  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus       149 ~~vLL~GppGtGKT~la~a  167 (389)
T 3vfd_A          149 RGLLLFGPPGNGKTMLAKA  167 (389)
T ss_dssp             SEEEEESSTTSCHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4689999999999999975

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}

Probab=95.58  E-value=0.007  Score=39.92  Aligned_cols=19  Identities=21%  Similarity=0.212  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      --+.+.|++|+|||+|+..
T Consensus       148 ~~v~I~G~~GiGKTtLa~~  166 (591)
T 1z6t_A          148 GWVTIHGMAGCGKSVLAAE  166 (591)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             ceEEEEcCCCCCHHHHHHH
Confidence            3578999999999999985

>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica}

Probab=95.56  E-value=0.0075  Score=38.46  Aligned_cols=22  Identities=14%  Similarity=0.338  Sum_probs=19.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++++|.+.+|||+++.+
T Consensus         3 ~~~~klLLLG~geSGKSTi~KQ   24 (340)
T 4fid_A            3 AKPITVMLLGSGESGKSTIAKQ   24 (340)
T ss_dssp             -CCEEEEEEECTTSSHHHHHHH
T ss_pred             CCcceEEEECCCCCcHHHHHHH
Confidence            3568999999999999999975

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G

Probab=95.55  E-value=0.0042  Score=38.20  Aligned_cols=18  Identities=33%  Similarity=0.538  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        47 ~vLl~G~~GtGKT~la~~   64 (350)
T 1g8p_A           47 GVLVFGDRGTGKSTAVRA   64 (350)
T ss_dssp             CEEEECCGGGCTTHHHHH
T ss_pred             eEEEECCCCccHHHHHHH
Confidence            489999999999999975

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*

Probab=95.55  E-value=0.0077  Score=37.99  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        85 ~~iLL~GppGtGKT~la~a  103 (355)
T 2qp9_X           85 SGILLYGPPGTGKSYLAKA  103 (355)
T ss_dssp             CCEEEECSTTSCHHHHHHH
T ss_pred             ceEEEECCCCCcHHHHHHH
Confidence            3588999999999999975

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=95.55  E-value=0.007  Score=41.14  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus       105 i~~LvGpNGaGKSTLLki  122 (608)
T 3j16_B          105 VLGLVGTNGIGKSTALKI  122 (608)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            477899999999999974

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}

Probab=95.54  E-value=0.0072  Score=35.35  Aligned_cols=19  Identities=16%  Similarity=0.207  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++.|..|+|||++..+
T Consensus         6 ~~I~l~G~~GsGKsT~a~~   24 (217)
T 3be4_A            6 HNLILIGAPGSGKGTQCEF   24 (217)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5789999999999999875

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=95.49  E-value=0.0085  Score=40.68  Aligned_cols=18  Identities=28%  Similarity=0.350  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus       119 ~~~LiG~NGsGKSTLlki  136 (607)
T 3bk7_A          119 VVGIVGPNGTGKTTAVKI  136 (607)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            578999999999999974

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=95.47  E-value=0.0079  Score=40.28  Aligned_cols=18  Identities=33%  Similarity=0.425  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 i~gLiGpNGaGKSTLlki   44 (538)
T 3ozx_A           27 ILGVLGKNGVGKTTVLKI   44 (538)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            467899999999999973

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}

Probab=95.47  E-value=0.011  Score=36.18  Aligned_cols=21  Identities=19%  Similarity=0.166  Sum_probs=18.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.|.+.|.+|+|||++...
T Consensus        74 ~~~iI~I~G~~GSGKSTva~~   94 (281)
T 2f6r_A           74 GLYVLGLTGISGSGKSSVAQR   94 (281)
T ss_dssp             TCEEEEEEECTTSCHHHHHHH
T ss_pred             CCEEEEEECCCCCCHHHHHHH
Confidence            356799999999999999974

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A

Probab=95.47  E-value=0.014  Score=34.79  Aligned_cols=20  Identities=25%  Similarity=0.222  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|+.|+|||+++.+
T Consensus        26 g~~i~i~G~~GsGKsT~~~~   45 (229)
T 4eaq_A           26 SAFITFEGPEGSGKTTVINE   45 (229)
T ss_dssp             CEEEEEECCTTSCHHHHHHH
T ss_pred             CeEEEEEcCCCCCHHHHHHH
Confidence            45688999999999999975

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}

Probab=95.46  E-value=0.015  Score=34.85  Aligned_cols=18  Identities=22%  Similarity=0.209  Sum_probs=15.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+++|+.|+||++...+
T Consensus        31 iI~llGpPGsGKgTqa~~   48 (217)
T 3umf_A           31 VIFVLGGPGSGKGTQCEK   48 (217)
T ss_dssp             EEEEECCTTCCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            356789999999998875

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}

Probab=95.44  E-value=0.0081  Score=39.28  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        52 ~vLL~GppGtGKTtlAr~   69 (447)
T 3pvs_A           52 SMILWGPPGTGKTTLAEV   69 (447)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            589999999999999974

>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A

Probab=95.44  E-value=0.0068  Score=39.72  Aligned_cols=22  Identities=32%  Similarity=0.425  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|..++|||||+.+
T Consensus        41 k~~~~i~iiG~vd~GKSTLi~~   62 (467)
T 1r5b_A           41 KEHVNIVFIGHVDAGKSTLGGN   62 (467)
T ss_dssp             CEEEEEEEEECGGGTHHHHHHH
T ss_pred             CCeeEEEEEECCCCCHHHHHHH
Confidence            4568999999999999999986

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}

Probab=95.43  E-value=0.0085  Score=40.71  Aligned_cols=16  Identities=31%  Similarity=0.439  Sum_probs=14.3

Q ss_pred             EEEEECCCCChHHHHH
Q psy15257         14 KCVVVGDTAVGKTRLI   29 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~   29 (65)
                      .+.++|++|+|||+|+
T Consensus        46 ~~~liGpNGaGKSTLl   61 (670)
T 3ux8_A           46 LVVLTGLSGSGKSSLA   61 (670)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHh
Confidence            3679999999999996

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*

Probab=95.43  E-value=0.0069  Score=39.67  Aligned_cols=18  Identities=39%  Similarity=0.566  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|..+
T Consensus         4 ~i~i~GptgsGKttla~~   21 (409)
T 3eph_A            4 VIVIAGTTGVGKSQLSIQ   21 (409)
T ss_dssp             EEEEEECSSSSHHHHHHH
T ss_pred             EEEEECcchhhHHHHHHH
Confidence            467899999999999985

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1

Probab=95.43  E-value=0.0053  Score=38.25  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+++..
T Consensus         6 v~~i~G~~GaGKTTll~~   23 (318)
T 1nij_A            6 VTLLTGFLGAGKTTLLRH   23 (318)
T ss_dssp             EEEEEESSSSSCHHHHHH
T ss_pred             EEEEEecCCCCHHHHHHH
Confidence            567889999999999985

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B

Probab=95.42  E-value=0.0075  Score=37.80  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=14.3

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|++|.|||+++-.
T Consensus        27 ~i~G~NGsGKS~lleA   42 (339)
T 3qkt_A           27 LIIGQNGSGKSSLLDA   42 (339)
T ss_dssp             EEECCTTSSHHHHHHH
T ss_pred             EEECCCCCCHHHHHHH
Confidence            5779999999999975

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...

Probab=95.39  E-value=0.012  Score=35.34  Aligned_cols=21  Identities=24%  Similarity=0.447  Sum_probs=17.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++.|..|+|||+++..
T Consensus        23 ~~~~I~ieG~~GsGKST~~~~   43 (263)
T 1p5z_B           23 RIKKISIEGNIAAGKSTFVNI   43 (263)
T ss_dssp             CCEEEEEECSTTSSHHHHHTT
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            346789999999999999974

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*

Probab=95.39  E-value=0.0081  Score=37.16  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.|+|||+++..
T Consensus        40 ~~ll~G~~G~GKT~la~~   57 (373)
T 1jr3_A           40 AYLFSGTRGVGKTSIARL   57 (373)
T ss_dssp             EEEEESCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468899999999999975

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A

Probab=95.38  E-value=0.0089  Score=38.49  Aligned_cols=19  Identities=32%  Similarity=0.305  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+++..
T Consensus       170 ~~i~l~G~~GsGKSTl~~~  188 (377)
T 1svm_A          170 RYWLFKGPIDSGKTTLAAA  188 (377)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3678899999999999974

>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ...

Probab=95.37  E-value=0.013  Score=37.31  Aligned_cols=22  Identities=23%  Similarity=0.397  Sum_probs=19.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++++|.+.+|||+++.+
T Consensus        30 ~~~~klLlLG~geSGKST~~KQ   51 (353)
T 1cip_A           30 AREVKLLLLGAGESGKSTIVKQ   51 (353)
T ss_dssp             -CEEEEEEECSTTSSHHHHHHH
T ss_pred             cccceEEEEcCCCCCchhHHHH
Confidence            4578999999999999999986

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=95.33  E-value=0.01  Score=39.70  Aligned_cols=18  Identities=22%  Similarity=0.348  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus       296 i~~i~G~nGsGKSTLl~~  313 (538)
T 3ozx_A          296 IIGILGPNGIGKTTFARI  313 (538)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999974

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=95.31  E-value=0.011  Score=39.55  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus       314 ~~~i~G~NGsGKSTLlk~  331 (538)
T 1yqt_A          314 VIGIVGPNGIGKTTFVKM  331 (538)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20

Probab=95.30  E-value=0.011  Score=35.80  Aligned_cols=18  Identities=33%  Similarity=0.409  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|+.|+|||+++..
T Consensus        48 ~~ll~G~~G~GKT~la~~   65 (327)
T 1iqp_A           48 HLLFAGPPGVGKTTAALA   65 (327)
T ss_dssp             EEEEESCTTSSHHHHHHH
T ss_pred             eEEEECcCCCCHHHHHHH
Confidence            388999999999999975

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.28  E-value=0.011  Score=38.79  Aligned_cols=19  Identities=32%  Similarity=0.408  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.||+|+|||+++..
T Consensus       207 rGiLL~GPPGtGKT~lakA  225 (428)
T 4b4t_K          207 RGVLLYGPPGTGKTMLVKA  225 (428)
T ss_dssp             CEEEEESCTTTTHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            3589999999999999975

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=95.27  E-value=0.011  Score=40.12  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus       384 i~~i~G~NGsGKSTLlk~  401 (607)
T 3bk7_A          384 VIGIVGPNGIGKTTFVKM  401 (607)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.26  E-value=0.0074  Score=37.51  Aligned_cols=18  Identities=33%  Similarity=0.517  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++|++|+|||+|+..
T Consensus        26 ~~~i~G~NGsGKS~ll~a   43 (322)
T 1e69_A           26 VTAIVGPNGSGKSNIIDA   43 (322)
T ss_dssp             EEEEECCTTTCSTHHHHH
T ss_pred             cEEEECCCCCcHHHHHHH
Confidence            357889999999999976

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A

Probab=95.26  E-value=0.011  Score=38.43  Aligned_cols=19  Identities=26%  Similarity=0.323  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus       168 ~~vLL~GppGtGKT~lA~a  186 (444)
T 2zan_A          168 RGILLFGPPGTGKSYLAKA  186 (444)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*

Probab=95.25  E-value=0.015  Score=32.47  Aligned_cols=19  Identities=26%  Similarity=0.331  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|..|+|||++...
T Consensus         8 ~~i~l~G~~GsGKSTva~~   26 (168)
T 1zuh_A            8 QHLVLIGFMGSGKSSLAQE   26 (168)
T ss_dssp             CEEEEESCTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.24  E-value=0.011  Score=39.01  Aligned_cols=19  Identities=21%  Similarity=0.310  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        78 ~~lLL~GppGtGKTtla~~   96 (516)
T 1sxj_A           78 RAAMLYGPPGIGKTTAAHL   96 (516)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4688999999999999975

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*

Probab=95.24  E-value=0.011  Score=38.11  Aligned_cols=19  Identities=32%  Similarity=0.366  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|.+|+|||+++.+
T Consensus       259 ~lIil~G~pGSGKSTla~~  277 (416)
T 3zvl_A          259 EVVVAVGFPGAGKSTFIQE  277 (416)
T ss_dssp             CEEEEESCTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4578899999999999985

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}

Probab=95.22  E-value=0.012  Score=36.47  Aligned_cols=19  Identities=26%  Similarity=0.441  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||.++..
T Consensus        26 ~~vLi~Ge~GtGKt~lAr~   44 (304)
T 1ojl_A           26 ATVLIHGDSGTGKELVARA   44 (304)
T ss_dssp             SCEEEESCTTSCHHHHHHH
T ss_pred             CcEEEECCCCchHHHHHHH
Confidence            4588999999999999874

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.22  E-value=0.01  Score=35.91  Aligned_cols=17  Identities=24%  Similarity=0.470  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++..
T Consensus        45 ~ll~G~~G~GKt~la~~   61 (323)
T 1sxj_B           45 MIISGMPGIGKTTSVHC   61 (323)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECcCCCCHHHHHHH
Confidence            89999999999999875

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}

Probab=95.21  E-value=0.01  Score=39.52  Aligned_cols=18  Identities=44%  Similarity=0.595  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+|||+|+..
T Consensus        66 GvLL~GppGtGKTtLara   83 (499)
T 2dhr_A           66 GVLLVGPPGVGKTHLARA   83 (499)
T ss_dssp             EEEEECSSSSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            389999999999999974

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=95.21  E-value=0.0083  Score=39.67  Aligned_cols=18  Identities=28%  Similarity=0.398  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|++|+|||+|+..
T Consensus        41 ~~~l~G~nGsGKSTL~~~   58 (525)
T 1tf7_A           41 STLVSGTSGTGKTLFSIQ   58 (525)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467899999999999975

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*

Probab=95.21  E-value=0.0084  Score=37.52  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=15.1

Q ss_pred             EEEE--ECCCCChHHHHHhH
Q psy15257         14 KCVV--VGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~--lG~~gvGKTsl~~~   31 (65)
                      -+++  .|++|+|||+++..
T Consensus        52 ~~li~i~G~~G~GKT~L~~~   71 (412)
T 1w5s_A           52 NMIYGSIGRVGIGKTTLAKF   71 (412)
T ss_dssp             EEEEECTTCCSSSHHHHHHH
T ss_pred             EEEEeCcCcCCCCHHHHHHH
Confidence            4556  79999999999975

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}

Probab=95.18  E-value=0.0092  Score=35.28  Aligned_cols=18  Identities=28%  Similarity=0.580  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.|++|+|||+++..
T Consensus        18 gvli~G~SGaGKStlal~   35 (181)
T 3tqf_A           18 GVLITGEANIGKSELSLA   35 (181)
T ss_dssp             EEEEEESSSSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            478999999999999975

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10

Probab=95.18  E-value=0.012  Score=36.97  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++..
T Consensus        56 ~~~i~i~G~~g~GKSTl~~~   75 (341)
T 2p67_A           56 TLRLGVTGTPGAGKSTFLEA   75 (341)
T ss_dssp             SEEEEEEECTTSCHHHHHHH
T ss_pred             CEEEEEEcCCCCCHHHHHHH
Confidence            46788999999999999985

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A

Probab=95.17  E-value=0.012  Score=35.51  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++..
T Consensus        41 ~ll~G~~G~GKt~la~~   57 (319)
T 2chq_A           41 LLFSGPPGTGKTATAIA   57 (319)
T ss_dssp             EEEESSSSSSHHHHHHH
T ss_pred             EEEECcCCcCHHHHHHH
Confidence            89999999999999975

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}

Probab=95.17  E-value=0.011  Score=40.55  Aligned_cols=19  Identities=32%  Similarity=0.497  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+++..
T Consensus       202 ~~vLL~G~pGtGKT~la~~  220 (758)
T 3pxi_A          202 NNPVLIGEPGVGKTAIAEG  220 (758)
T ss_dssp             CEEEEESCTTTTTHHHHHH
T ss_pred             CCeEEECCCCCCHHHHHHH
Confidence            3589999999999999974

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12

Probab=95.17  E-value=0.011  Score=38.08  Aligned_cols=17  Identities=24%  Similarity=0.524  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .+++|++|+|||+|+..
T Consensus        29 ~~i~G~nG~GKstll~a   45 (430)
T 1w1w_A           29 TSIIGPNGSGKSNMMDA   45 (430)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57889999999999975

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}

Probab=95.16  E-value=0.015  Score=38.65  Aligned_cols=19  Identities=11%  Similarity=0.242  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||.++..
T Consensus        42 ~~VLL~GpPGtGKT~LAra   60 (500)
T 3nbx_X           42 ESVFLLGPPGIAKSLIARR   60 (500)
T ss_dssp             CEEEEECCSSSSHHHHHHH
T ss_pred             CeeEeecCchHHHHHHHHH
Confidence            3689999999999999975

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}

Probab=95.15  E-value=0.011  Score=34.44  Aligned_cols=18  Identities=28%  Similarity=0.501  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++.+
T Consensus        32 l~~i~G~pG~GKT~l~l~   49 (251)
T 2zts_A           32 TVLLTGGTGTGKTTFAAQ   49 (251)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            467889999999999886

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*

Probab=95.15  E-value=0.012  Score=38.90  Aligned_cols=18  Identities=39%  Similarity=0.460  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++..
T Consensus        51 gvLL~GppGtGKT~Lara   68 (476)
T 2ce7_A           51 GILLVGPPGTGKTLLARA   68 (476)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            488999999999999974

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}

Probab=95.14  E-value=0.011  Score=37.73  Aligned_cols=18  Identities=33%  Similarity=0.477  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++|++|+|||+++..
T Consensus        28 ~~~i~G~nG~GKttll~a   45 (359)
T 2o5v_A           28 VTGIYGENGAGKTNLLEA   45 (359)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEECCCCCChhHHHHH
Confidence            467889999999999975

>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H

Probab=95.12  E-value=0.018  Score=39.68  Aligned_cols=23  Identities=13%  Similarity=0.020  Sum_probs=20.2

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+++++|..++|||||+.+
T Consensus         7 ~~~~~~I~IiG~~~~GKTTL~~~   29 (704)
T 2rdo_7            7 IARYRNIGISAHIDAGKTTTTER   29 (704)
T ss_pred             cccccEEEEECCCCCCHHHHHHH
Confidence            34568999999999999999996

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.11  E-value=0.013  Score=38.54  Aligned_cols=20  Identities=30%  Similarity=0.297  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+++.||+|+|||.++..
T Consensus       215 prGvLLyGPPGTGKTllAkA  234 (434)
T 4b4t_M          215 PKGALMYGPPGTGKTLLARA  234 (434)
T ss_dssp             CCEEEEESCTTSSHHHHHHH
T ss_pred             CCeeEEECcCCCCHHHHHHH
Confidence            35689999999999999975

>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B

Probab=95.08  E-value=0.017  Score=42.46  Aligned_cols=22  Identities=32%  Similarity=0.398  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|+.++|||||+.+
T Consensus       294 k~~lnIvIIGhvDvGKSTLInr  315 (1289)
T 3avx_A          294 KPHVNVGTIGHVDHGKTTLTAA  315 (1289)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHH
T ss_pred             CCeeEEEEEcCCCCCHHHHHHH
Confidence            4568999999999999999986

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}

Probab=95.07  E-value=0.0035  Score=39.77  Aligned_cols=18  Identities=33%  Similarity=0.645  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++|++|+|||+|+..
T Consensus        62 ~~~lvG~NGaGKStLl~a   79 (415)
T 4aby_A           62 FCAFTGETGAGKSIIVDA   79 (415)
T ss_dssp             EEEEEESHHHHHHHHTHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            578899999999999964

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}

Probab=95.02  E-value=0.0089  Score=43.63  Aligned_cols=18  Identities=22%  Similarity=0.503  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      |+.++|++|+|||+|+.-
T Consensus      1107 ~vaIVG~SGsGKSTL~~l 1124 (1321)
T 4f4c_A         1107 TLALVGPSGCGKSTVVAL 1124 (1321)
T ss_dssp             EEEEECSTTSSTTSHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            688999999999999973

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.02  E-value=0.014  Score=38.38  Aligned_cols=19  Identities=32%  Similarity=0.337  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.||+|+|||.++..
T Consensus       216 rGvLL~GPPGtGKTllAkA  234 (437)
T 4b4t_L          216 KGVLLYGPPGTGKTLLAKA  234 (437)
T ss_dssp             CEEEEESCTTSSHHHHHHH
T ss_pred             CeEEEECCCCCcHHHHHHH
Confidence            4689999999999999975

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*

Probab=95.00  E-value=0.015  Score=39.81  Aligned_cols=19  Identities=32%  Similarity=0.499  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+++..
T Consensus       208 ~~vlL~G~~GtGKT~la~~  226 (758)
T 1r6b_X          208 NNPLLVGESGVGKTAIAEG  226 (758)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CCeEEEcCCCCCHHHHHHH
Confidence            4679999999999999974

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A

Probab=95.00  E-value=0.014  Score=36.60  Aligned_cols=19  Identities=26%  Similarity=0.340  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++..
T Consensus       106 ~vI~ivG~~G~GKTT~~~~  124 (320)
T 1zu4_A          106 NIFMLVGVNGTGKTTSLAK  124 (320)
T ss_dssp             EEEEEESSTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4578889999999999975

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}

Probab=95.00  E-value=0.013  Score=39.32  Aligned_cols=18  Identities=28%  Similarity=0.488  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus        62 ~vll~Gp~GtGKTtlar~   79 (604)
T 3k1j_A           62 HVLLIGEPGTGKSMLGQA   79 (604)
T ss_dssp             CEEEECCTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            578999999999999974

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*

Probab=94.92  E-value=0.015  Score=37.78  Aligned_cols=19  Identities=32%  Similarity=0.415  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        64 ~~iLl~GppGtGKT~la~a   82 (456)
T 2c9o_A           64 RAVLLAGPPGTGKTALALA   82 (456)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CeEEEECCCcCCHHHHHHH
Confidence            3589999999999999975

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=94.88  E-value=0.015  Score=39.62  Aligned_cols=17  Identities=41%  Similarity=0.618  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus       381 v~iiG~NGsGKSTLlk~  397 (608)
T 3j16_B          381 LVMMGENGTGKTTLIKL  397 (608)
T ss_dssp             EEEESCTTSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            68999999999999974

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}

Probab=94.88  E-value=0.022  Score=41.64  Aligned_cols=18  Identities=28%  Similarity=0.580  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus       446 ~vaivG~sGsGKSTll~l  463 (1321)
T 4f4c_A          446 TVALVGSSGCGKSTIISL  463 (1321)
T ss_dssp             EEEEEECSSSCHHHHHHH
T ss_pred             EEEEEecCCCcHHHHHHH
Confidence            578999999999999973

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*

Probab=94.88  E-value=0.021  Score=32.60  Aligned_cols=18  Identities=22%  Similarity=0.302  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.+.|++|+|||++...
T Consensus         4 ~i~i~G~~GsGKst~~~~   21 (208)
T 3ake_A            4 IVTIDGPSASGKSSVARR   21 (208)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999874

>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11

Probab=94.84  E-value=0.017  Score=38.44  Aligned_cols=18  Identities=44%  Similarity=0.516  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+..
T Consensus       153 ~~~i~G~sGvGKTtL~~~  170 (473)
T 1sky_E          153 KIGLFGGAGVGKTVLIQE  170 (473)
T ss_dssp             EEEEECCSSSCHHHHHHH
T ss_pred             EEEEECCCCCCccHHHHH
Confidence            688999999999999974

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Length	Definition	E-value
Query	65
d2atxa1	185	c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax	9e-06
d2fn4a1	173	c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T	2e-04
d2ngra_	191	c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId:	2e-04
d1wmsa_	174	c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId:	3e-04
d1kmqa_	177	c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9	4e-04
d2f9la1	175	c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T	4e-04
d1vg8a_	184	c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId	4e-04
d2atva1	168	c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro	5e-04
d1mh1a_	183	c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96	7e-04
d2f7sa1	186	c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T	8e-04
d1zj6a1	177	c.37.1.8 (A:2-178) ADP-ribosylation factor {Human	0.001
d2ew1a1	171	c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta	0.001
d1m7ba_	179	c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T	0.001
d1yzqa1	164	c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta	0.001
d1z0fa1	166	c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta	0.001
d1g16a_	166	c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye	0.002
d2a5ja1	173	c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta	0.002
d2g6ba1	170	c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T	0.002
d1ky3a_	175	c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y	0.002
d2erya1	171	c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [	0.002
d1z08a1	167	c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T	0.002
d2g3ya1	172	c.37.1.8 (A:73-244) GTP-binding protein GEM {Human	0.002
d1u8za_	168	c.37.1.8 (A:) Ras-related protein RalA {Cotton-top	0.002
d1ek0a_	170	c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces	0.002
d1kaoa_	167	c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId:	0.002
d1ctqa_	166	c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi	0.002
d2bcgy1	194	c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac	0.003
d1z06a1	165	c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus)	0.003
d3raba_	169	c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI	0.003
d1z2aa1	164	c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta	0.003
d1z0ja1	167	c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [	0.003
d2fu5c1	173	c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta	0.004
d2qtvb1	166	c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom	0.004
d1c1ya_	167	c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId:	0.004
d2bmea1	174	c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta	0.004
d1r2qa_	170	c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId:	0.004
d2bmja1	175	c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H	0.004

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoQ
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.4 bits (88), Expect = 9e-06
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 8  PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          P   ++KCVVVGD AVGKT L+     N       + T       ++   
Sbjct: 5  PGALMLKCVVVGDGAVGKTCLLM-SYANDAFPEEYVPTVFDHYAVSVTVG 53

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 11/22 (50%), Positives = 12/22 (54%)

Query: 8  PHQELVKCVVVGDTAVGKTRLI 29
          P  E  K VVVG   VGK+ L 
Sbjct: 2  PPSETHKLVVVGGGGVGKSALT 23

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY 60
          +KCVVVGD AVGKT L+ +   NK  S       +VPTV+      + 
Sbjct: 4  IKCVVVGDGAVGKTCLLISYTTNKFPS------EYVPTVFDNYAVTVM 45

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab9a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.2 bits (77), Expect = 3e-04
 Identities = 11/46 (23%), Positives = 19/46 (41%), Gaps = 1/46 (2%)

Query: 12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          L K +++GD  VGK+ L+  R    +       T  V  +    + 
Sbjct: 6  LFKVILLGDGGVGKSSLMN-RYVTNKFDTQLFHTIGVEFLNKDLEV 50

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoA
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.8 bits (76), Expect = 4e-04
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD 62
          K V+VGD A GKT L+   + ++          +VPTV+      I  D
Sbjct: 4  KLVIVGDGACGKTCLLIVNSKDQFPE------VYVPTVFENYVADIEVD 46

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab11b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.7 bits (76), Expect = 4e-04
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAID 55
          L K V++GD+ VGK+ L+     N+    S+          +I 
Sbjct: 4  LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQ 47

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab7
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 33.9 bits (76), Expect = 4e-04
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 6/50 (12%)

Query: 12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
          L+K +++GD+ VGKT L+       Q    +    +  T+ A    +   
Sbjct: 2  LLKVIILGDSGVGKTSLM------NQYVNKKFSNQYKATIGADFLTKEVM 45

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-like estrogen-regulated growth inhibitor, RERG
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.8 bits (76), Expect = 5e-04
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 6/50 (12%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD 62
          VK  + G   VGK+ L+  R   K+         + PT+ +  +++   D
Sbjct: 3  VKLAIFGRAGVGKSALV-VRFLTKRFI-----WEYDPTLESTYRHQATID 46

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rac
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.4 bits (75), Expect = 7e-04
 Identities = 14/49 (28%), Positives = 20/49 (40%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK 61
          +KCVVVGD AVGKT L+ +   N              +   +   +   
Sbjct: 6  IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVN 54

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab27b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.9 bits (74), Expect = 8e-04
 Identities = 10/41 (24%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW 52
          L+K + +GD+ VGKT  +  R  + + +   + T  +    
Sbjct: 5  LIKLLALGDSGVGKTTFLY-RYTDNKFNPKFITTVGIDFRE 44

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL5A [TaxId: 9606]

 Score = 32.7 bits (73), Expect = 0.001
 Identities = 11/50 (22%), Positives = 23/50 (46%)

Query: 14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          K ++VG    GKT ++   + N+ V  S  + ++V  +   +   +  D 
Sbjct: 17 KVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDI 66

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab30
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.9 bits (74), Expect = 0.001
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K V++G+  VGKT L+
Sbjct: 5  LFKIVLIGNAGVGKTCLV 22

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoE (RND3)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 32.7 bits (73), Expect = 0.001
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 6/50 (12%)

Query: 13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD 62
           K VVVGD+  GKT L+         +       +VPTV+         D
Sbjct: 3  CKIVVVGDSQCGKTALL------HVFAKDCFPENYVPTVFENYTASFEID 46

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.6 bits (73), Expect = 0.001
 Identities = 11/50 (22%), Positives = 17/50 (34%), Gaps = 1/50 (2%)

Query: 14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT 63
          K V +G+ +VGKT LI  R        +   T  +  +            
Sbjct: 2  KLVFLGEQSVGKTSLIT-RFMYDSFDNTYQATIGIDFLSKTMYLEDRTIR 50

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab14
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.2 bits (72), Expect = 0.001
 Identities = 7/18 (38%), Positives = 13/18 (72%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          + K +++GD  VGK+ L+
Sbjct: 4  IFKYIIIGDMGVGKSCLL 21

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 32.4 bits (73), Expect = 0.002
 Identities = 10/37 (27%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHV 48
          ++K +++GD+ VGK+ L+  R    + + S + T  +
Sbjct: 2  IMKILLIGDSGVGKSCLL-VRFVEDKFNPSFITTIGI 37

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab2b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.2 bits (72), Expect = 0.002
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K +++GDT VGK+ L+
Sbjct: 3  LFKYIIIGDTGVGKSCLL 20

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab26
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.2 bits (72), Expect = 0.002
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
            K ++VGD+ VGKT L+
Sbjct: 6  AFKVMLVGDSGVGKTCLL 23

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein ypt7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 32.0 bits (71), Expect = 0.002
 Identities = 8/18 (44%), Positives = 15/18 (83%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          ++K +++GD+ VGKT L+
Sbjct: 2  ILKVIILGDSGVGKTSLM 19

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.9 bits (71), Expect = 0.002
 Identities = 10/20 (50%), Positives = 12/20 (60%)

Query: 10 QELVKCVVVGDTAVGKTRLI 29
          QE  + VVVG   VGK+ L 
Sbjct: 3  QEKYRLVVVGGGGVGKSALT 22

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab21
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.8 bits (71), Expect = 0.002
 Identities = 8/18 (44%), Positives = 12/18 (66%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
            K V++G+  VGKT L+
Sbjct: 3  SFKVVLLGEGCVGKTSLV 20

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein GEM
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.0 bits (71), Expect = 0.002
 Identities = 9/44 (20%), Positives = 14/44 (31%)

Query: 14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY 57
          + V++G+  VGK+ L    A       S        T       
Sbjct: 5  RVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMV 48

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein RalA
species: Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]

 Score = 31.8 bits (71), Expect = 0.002
 Identities = 8/18 (44%), Positives = 11/18 (61%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K ++VG   VGK+ L 
Sbjct: 4  LHKVIMVGSGGVGKSALT 21

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ypt51
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 31.9 bits (71), Expect = 0.002
 Identities = 7/17 (41%), Positives = 14/17 (82%)

Query: 13 VKCVVVGDTAVGKTRLI 29
          +K V++G+ AVGK+ ++
Sbjct: 4  IKLVLLGEAAVGKSSIV 20

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap2a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.8 bits (71), Expect = 0.002
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 14 KCVVVGDTAVGKTRLI 29
          K VV+G   VGK+ L 
Sbjct: 5  KVVVLGSGGVGKSALT 20

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: cH-p21 Ras protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.9 bits (71), Expect = 0.002
 Identities = 9/16 (56%), Positives = 10/16 (62%)

Query: 14 KCVVVGDTAVGKTRLI 29
          K VVVG   VGK+ L 
Sbjct: 5  KLVVVGAGGVGKSALT 20

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Ytp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 31.8 bits (71), Expect = 0.003
 Identities = 7/18 (38%), Positives = 14/18 (77%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K +++G++ VGK+ L+
Sbjct: 6  LFKLLLIGNSGVGKSCLL 23

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-33b
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 31.5 bits (70), Expect = 0.003
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          + K +V+GD+ VGKT L 
Sbjct: 2  IFKIIVIGDSNVGKTCLT 19

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab3a
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 31.4 bits (70), Expect = 0.003
 Identities = 6/18 (33%), Positives = 14/18 (77%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          + K +++G+++VGKT  +
Sbjct: 5  MFKILIIGNSSVGKTSFL 22

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 31.6 bits (70), Expect = 0.003
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 13 VKCVVVGDTAVGKTRLI 29
          +K VVVG+ AVGK+ +I
Sbjct: 3  IKMVVVGNGAVGKSSMI 19

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-22a
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 31.5 bits (70), Expect = 0.003
 Identities = 7/17 (41%), Positives = 13/17 (76%)

Query: 13 VKCVVVGDTAVGKTRLI 29
          +K  ++GDT VGK+ ++
Sbjct: 5  LKVCLLGDTGVGKSSIM 21

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 31.3 bits (70), Expect = 0.004
 Identities = 8/18 (44%), Positives = 14/18 (77%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K +++GD+ VGKT ++
Sbjct: 6  LFKLLLIGDSGVGKTCVL 23

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 31.2 bits (69), Expect = 0.004
 Identities = 10/49 (20%), Positives = 18/49 (36%), Gaps = 7/49 (14%)

Query: 14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD 62
          K + +G    GKT L+     N +++      T  PT     +     +
Sbjct: 2  KLLFLGLDNAGKTTLL-HMLKNDRLA------TLQPTWHPTSEELAIGN 43

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap1A
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.1 bits (69), Expect = 0.004
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 14 KCVVVGDTAVGKTRLI 29
          K VV+G   VGK+ L 
Sbjct: 5  KLVVLGSGGVGKSALT 20

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab4a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.0 bits (69), Expect = 0.004
 Identities = 7/18 (38%), Positives = 12/18 (66%)

Query: 12 LVKCVVVGDTAVGKTRLI 29
          L K +V+G+   GK+ L+
Sbjct: 5  LFKFLVIGNAGTGKSCLL 22

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab5a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.1 bits (69), Expect = 0.004
 Identities = 8/16 (50%), Positives = 14/16 (87%)

Query: 14 KCVVVGDTAVGKTRLI 29
          K V++G++AVGK+ L+
Sbjct: 8  KLVLLGESAVGKSSLV 23

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Centaurin gamma 1, G domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.1 bits (69), Expect = 0.004
 Identities = 7/17 (41%), Positives = 11/17 (64%)

Query: 13 VKCVVVGDTAVGKTRLI 29
          ++  V+GD   GK+ LI
Sbjct: 6  LRLGVLGDARSGKSSLI 22

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	65
d1c1ya_	167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	99.33
d2atxa1	185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	99.33
d2atva1	168	Ras-like estrogen-regulated growth inhibitor, RERG	99.28
d1mh1a_	183	Rac {Human (Homo sapiens) [TaxId: 9606]}	99.28
d1kaoa_	167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	99.28
d1u8za_	168	Ras-related protein RalA {Cotton-top tamarin (Sagu	99.28
d2erxa1	171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	99.27
d1xtqa1	167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	99.25
d2erya1	171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	99.25
d1z08a1	167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	99.25
d1i2ma_	170	Ran {Human (Homo sapiens) [TaxId: 9606]}	99.24
d2fn4a1	173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	99.24
d2ngra_	191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	99.23
d1svsa1	195	Transducin (alpha subunit) {Rat (Rattus norvegicus	99.23
d1kmqa_	177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	99.22
d1ctqa_	166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	99.22
d1m7ba_	179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	99.22
d1x1ra1	169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	99.21
d3raba_	169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	99.18
d2ew1a1	171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	99.18
d2bcjq2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	99.15
d2f7sa1	186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	99.14
d1z0ja1	167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	99.14
d1z0fa1	166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	99.13
d1ek0a_	170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	99.13
d1vg8a_	184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	99.12
d1z2aa1	164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	99.12
d2fu5c1	173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	99.12
d2bmea1	174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	99.11
d1yzqa1	164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	99.09
d2bcgy1	194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	99.08
d1r2qa_	170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	99.07
d1wmsa_	174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	99.06
d1g16a_	166	Rab-related protein Sec4 {Baker's yeast (Saccharom	99.06
d2a5ja1	173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	99.05
d1z06a1	165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	99.05
d2f9la1	175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	99.05
d1zcba2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	99.04
d1zd9a1	164	ADP-ribosylation factor {Human (Homo sapiens), ARL	99.0
d2g6ba1	170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	98.98
d1ky3a_	175	Rab-related protein ypt7p {Baker's yeast (Saccharo	98.95
d2gjsa1	168	Rad {Human (Homo sapiens) [TaxId: 9606]}	98.91
d2g3ya1	172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	98.87
d1x3sa1	177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	98.87
d2bmja1	175	Centaurin gamma 1, G domain {Human (Homo sapiens)	98.86
d1ksha_	165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	98.76
d1azta2	221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	98.67
d1r8sa_	160	ADP-ribosylation factor {Human (Homo sapiens), ARF	98.65
d1fzqa_	176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	98.64
d2qtvb1	166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	98.6
d1e0sa_	173	ADP-ribosylation factor {Human (Homo sapiens), ARF	98.59
d1upta_	169	ADP-ribosylation factor {Human (Homo sapiens), ARL	98.57
d1moza_	182	ADP-ribosylation factor {Baker's yeast (Saccharomy	98.53
d1f6ba_	186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	98.43
d1zj6a1	177	ADP-ribosylation factor {Human (Homo sapiens), ARL	98.39
d2fh5b1	207	Signal recognition particle receptor beta-subunit	98.19
d2gj8a1	161	Probable tRNA modification GTPase TrmE (MnmE), G d	97.99
d1vmaa2	213	GTPase domain of the signal recognition particle r	97.94
d1wf3a1	178	GTPase Era, N-terminal domain {Thermus thermophilu	97.92
d1puia_	188	Probable GTPase EngB {Escherichia coli [TaxId: 562	97.91
d1nrjb_	209	Signal recognition particle receptor beta-subunit	97.9
d1ye8a1	178	Hypothetical kinase-like protein Aq_1292 {Aquifex	97.89
d1mkya2	186	Probable GTPase Der, N-terminal and middle domains	97.87
d1xzpa2	160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	97.77
d1lw7a2	192	Transcriptional regulator NadR, ribosylnicotinamid	97.75
d1j8yf2	211	GTPase domain of the signal sequence recognition p	97.64
d1okkd2	207	GTPase domain of the signal recognition particle r	97.62
d1udxa2	180	Obg GTP-binding protein middle domain {Thermus the	97.61
d1ls1a2	207	GTPase domain of the signal sequence recognition p	97.61
d1egaa1	179	GTPase Era, N-terminal domain {Escherichia coli [T	97.6
d1lnza2	185	Obg GTP-binding protein middle domain {Bacillus su	97.6
d2qy9a2	211	GTPase domain of the signal recognition particle r	97.59
d1rkba_	173	Adenylate kinase {Human (Homo sapiens), isoenzyme	97.57
d1y63a_	174	Probable kinase LmjF30.1890 {Leishmania major [Tax	97.56
d1kaga_	169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	97.54
d1mkya1	171	Probable GTPase Der, N-terminal and middle domains	97.52
d1svia_	195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	97.43
d1gkya_	186	Guanylate kinase {Baker's yeast (Saccharomyces cer	97.43
d2cxxa1	184	GTP-binding protein engB {Pyrococcus horikoshii [T	97.38
d1kgda_	178	Guanylate kinase-like domain of Cask {Human (Homo	97.36
d1lvga_	190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	97.33
d2i3ba1	189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	97.31
d2bdta1	176	Hypothetical protein BH3686 {Bacillus halodurans [	97.31
d1znwa1	182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	97.3
d1s96a_	205	Guanylate kinase {Escherichia coli [TaxId: 562]}	97.27
d1ly1a_	152	Polynucleotide kinase, kinase domain {Bacteriophag	97.25
d1np6a_	170	Molybdopterin-guanine dinucleotide biosynthesis pr	97.22
d2iyva1	165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	97.2
d1u0la2	225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	97.18
d1h65a_	257	Chloroplast protein translocon GTPase Toc34 {Garde	97.15
d1m8pa3	183	ATP sulfurylase C-terminal domain {Fungus (Penicil	97.13
d1jbka_	195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	97.1
d1zina1	182	Adenylate kinase {Bacillus stearothermophilus [Tax	97.09
d2ak3a1	189	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.08
d1r6bx2	268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	97.08
d1knqa_	171	Gluconate kinase {Escherichia coli [TaxId: 562]}	97.06
d1ofha_	309	HslU {Haemophilus influenzae [TaxId: 727]}	97.05
d1ak2a1	190	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.05
d2fnaa2	283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	97.05
d2cdna1	181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	97.04
d1gvnb_	273	Plasmid maintenance system epsilon/zeta, toxin zet	97.03
d1ixsb2	239	Holliday junction helicase RuvB {Thermus thermophi	97.02
d1in4a2	238	Holliday junction helicase RuvB {Thermotoga mariti	96.99
d1g41a_	443	HslU {Haemophilus influenzae [TaxId: 727]}	96.98
d2onka1	240	Molybdate/tungstate import ATP-binding protein Wtp	96.98
d1viaa_	161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	96.96
d1jj7a_	251	Peptide transporter Tap1, C-terminal ABC domain {H	96.96
d1qf9a_	194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	96.96
d1s3ga1	182	Adenylate kinase {Bacillus globisporus [TaxId: 145	96.96
d1l2ta_	230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	96.95
d2pmka1	241	Haemolysin B ATP-binding protein {Escherichia coli	96.91
d1zaka1	189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	96.91
d1um8a_	364	ClpX {Helicobacter pylori [TaxId: 210]}	96.91
d1mv5a_	242	Multidrug resistance ABC transporter LmrA, C-termi	96.9
d2awna2	232	Maltose transport protein MalK, N-terminal domain	96.9
d1sgwa_	200	Putative ABC transporter PF0895 {Pyrococcus furios	96.9
d1xjca_	165	Molybdopterin-guanine dinucleotide biosynthesis pr	96.9
d1fnna2	276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	96.89
d1akya1	180	Adenylate kinase {Baker's yeast (Saccharomyces cer	96.88
d1t9ha2	231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	96.85
d2hyda1	255	Putative multidrug export ATP-binding/permease pro	96.84
d3b60a1	253	Multidrug resistance ABC transporter MsbA, C-termi	96.84
d1zp6a1	176	Hypothetical protein Atu3015 {Agrobacterium tumefa	96.83
d1e4va1	179	Adenylate kinase {Escherichia coli [TaxId: 562]}	96.83
d1yj5a2	172	5' polynucleotide kinase-3' phosphatase, C-termina	96.82
d1qhxa_	178	Chloramphenicol phosphotransferase {Streptomyces v	96.81
d1nksa_	194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	96.81
d1v43a3	239	Hypothetical protein PH0022, N-terminal domain {Py	96.8
d1w5sa2	287	CDC6-like protein APE0152, N-terminal domain {Aero	96.79
d1teva_	194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	96.78
d1khta_	190	Adenylate kinase {Archaeon Methanococcus voltae [T	96.78
d1wb1a4	179	Elongation factor SelB, N-terminal domain {Methano	96.77
d1tq4a_	400	Interferon-inducible GTPase {Mouse (Mus musculus)	96.76
d1r0wa_	281	Cystic fibrosis transmembrane conductance regulato	96.75
d1e6ca_	170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	96.75
d1sxja2	253	Replication factor C1 {Baker's yeast (Saccharomyce	96.72
d3dhwc1	240	Methionine import ATP-binding protein MetN {Escher	96.72
d3d31a2	229	Sulfate/molybdate ABC transporter, ATP-binding pro	96.69
d1g2912	240	Maltose transport protein MalK, N-terminal domain	96.67
d1bifa1	213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	96.66
d1yrba1	244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	96.64
d1d2na_	246	Hexamerization domain of N-ethylmalemide-sensitive	96.62
d1iqpa2	231	Replication factor C {Archaeon Pyrococcus furiosus	96.62
d1ukza_	196	Uridylate kinase {Baker's yeast (Saccharomyces cer	96.61
d1x6va3	195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	96.57
d1qvra2	387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	96.55
d1sxje2	252	Replication factor C5 {Baker's yeast (Saccharomyce	96.53
g1f2t.1	292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	96.51
d1oxxk2	242	Glucose transport protein GlcV, N-terminal domain	96.47
d1wxqa1	319	GTP-binding protein PH0525 {Pyrococcus horikoshii	96.46
d1sxjd2	237	Replication factor C2 {Baker's yeast (Saccharomyce	96.46
d1sxjb2	224	Replication factor C4 {Baker's yeast (Saccharomyce	96.43
d1r6bx3	315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	96.37
d1q3ta_	223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	96.36
d2vp4a1	197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	96.34
d1ji0a_	240	Branched chain aminoacid ABC transporter {Thermoto	96.34
d2p67a1	327	LAO/AO transport system kinase ArgK {Escherichia c	96.33
d1rz3a_	198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.32
d1b0ua_	258	ATP-binding subunit of the histidine permease {Sal	96.3
d1l7vc_	231	ABC transporter involved in vitamin B12 uptake, Bt	96.26
g1ii8.1	369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	96.24
d1ckea_	225	CMP kinase {Escherichia coli [TaxId: 562]}	96.22
d1l8qa2	213	Chromosomal replication initiation factor DnaA {Aq	96.21
d1ixza_	247	AAA domain of cell division protein FtsH {Thermus	96.21
d1g6ha_	254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	96.14
d3adka_	194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	96.13
d1sxjc2	227	Replication factor C3 {Baker's yeast (Saccharomyce	96.1
d1vpla_	238	Putative ABC transporter TM0544 {Thermotoga mariti	96.09
d1g6oa_	323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	96.09
d1n0wa_	242	DNA repair protein Rad51, catalytic domain {Human	96.08
d2a5yb3	277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	96.04
d1lv7a_	256	AAA domain of cell division protein FtsH {Escheric	96.04
d1qhla_	222	Cell division protein MukB {Escherichia coli [TaxI	96.03
d2qm8a1	323	Metallochaperone MeaB {Methylobacterium extorquens	96.03
d1e69a_	308	Smc head domain {Thermotoga maritima [TaxId: 2336]	96.03
d1e32a2	258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	95.99
g1xew.1	329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	95.95
d2akab1	299	Dynamin G domain {Rat (Rattus norvegicus) [TaxId:	95.94
d1kkma_	176	HPr kinase HprK C-terminal domain {Lactobacillus c	95.9
d1pzna2	254	DNA repair protein Rad51, catalytic domain {Archae	95.85
d1uj2a_	213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	95.85
d1szpa2	251	DNA repair protein Rad51, catalytic domain {Baker'	95.7
d2i1qa2	258	DNA repair protein Rad51, catalytic domain {Archae	95.7
d1knxa2	177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	95.63
d1jwyb_	306	Dynamin G domain {Dictyostelium discoideum [TaxId:	95.57
d1r7ra3	265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	95.55
d1w1wa_	427	Smc head domain {Baker's yeast (Saccharomyces cere	95.53
d1g8pa_	333	ATPase subunit of magnesium chelatase, BchI {Rhodo	95.5
d1v5wa_	258	Meiotic recombination protein DMC1/LIM15 homolog {	95.46
d1ko7a2	169	HPr kinase HprK C-terminal domain {Staphylococcus	95.46
d1m7ga_	208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	95.28
d1tf7a2	242	Circadian clock protein KaiC {Synechococcus sp. st	95.25
d1sq5a_	308	Pantothenate kinase PanK {Escherichia coli [TaxId:	95.16
d1jala1	278	YchF GTP-binding protein N-terminal domain {Haemop	95.02
d1puja_	273	Probable GTPase YlqF {Bacillus subtilis [TaxId: 14	95.0
d1qvra3	315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	94.96
d1w44a_	321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	94.91
d1tf7a1	242	Circadian clock protein KaiC {Synechococcus sp. st	94.86
d2c78a3	204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	94.85
d1pjra1	318	DEXX box DNA helicase {Bacillus stearothermophilus	94.78
d1cr2a_	277	Gene 4 protein (g4p, DNA primase), helicase domain	94.66
d1p5zb_	241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	94.63
d1ihua1	296	Arsenite-translocating ATPase ArsA {Escherichia co	94.56
d1ni3a1	296	YchF GTP-binding protein N-terminal domain {Fissio	94.53
d1njfa_	239	delta prime subunit of DNA polymerase III, N-domai	94.53
d1a5ta2	207	delta prime subunit of DNA polymerase III, N-domai	94.47
d1nlfa_	274	Hexameric replicative helicase repA {Escherichia c	94.44
d1uaaa1	306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	94.4
d1svma_	362	Papillomavirus large T antigen helicase domain {Si	94.34
d1cp2a_	269	Nitrogenase iron protein {Clostridium pasteurianum	94.33
d1e9ra_	433	Bacterial conjugative coupling protein TrwB {Esche	94.33
d1g7sa4	227	Initiation factor IF2/eIF5b, N-terminal (G) domain	94.27
d1a7ja_	288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	94.19
d1kk1a3	195	Initiation factor eIF2 gamma subunit, N-terminal (	94.12
d1gsia_	208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	94.06
d1htwa_	158	Hypothetical protein HI0065 {Haemophilus influenza	94.04
d1uf9a_	191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	94.04
d1xpua3	289	Transcription termination factor Rho, ATPase domai	93.97
d1zunb3	222	Sulfate adenylate transferase subunit cysN/C, EF-T	93.88
d1ihua2	279	Arsenite-translocating ATPase ArsA {Escherichia co	93.76
d1p9ra_	401	Extracellular secretion NTPase EpsE {Vibrio choler	93.6
d2qn6a3	205	Initiation factor eIF2 gamma subunit, N-terminal (	93.55
d2afhe1	289	Nitrogenase iron protein {Azotobacter vinelandii [	93.48
d1byia_	224	Dethiobiotin synthetase {Escherichia coli [TaxId:	93.34
d1odfa_	286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	93.24
d2dy1a2	267	Elongation factor G (EF-G), N-terminal (G) domain	92.89
d2bv3a2	276	Elongation factor G (EF-G), N-terminal (G) domain	92.53
d1f5na2	277	Interferon-induced guanylate-binding protein 1 (GB	92.39
d1d2ea3	196	Elongation factor Tu (EF-Tu), N-terminal (G) domai	92.39
d1nija1	222	Hypothetical protein YjiA, N-terminal domain {Esch	92.28
d1vhta_	208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	92.23
d1jjva_	205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	92.12
d1nn5a_	209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	92.02
d2jdid3	276	Central domain of beta subunit of F1 ATP synthase	92.0
d4tmka_	210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	91.93
d1a1va1	136	HCV helicase domain {Human hepatitis C virus (HCV)	91.59
d1p6xa_	333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	91.2
d1f60a3	239	Elongation factor eEF-1alpha, N-terminal (G) domai	91.16
d1ny5a2	247	Transcriptional activator sigm54 (NtrC1), C-termin	91.08
d1w36d1	359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	90.93
d1e2ka_	329	Thymidine kinase {Herpes simplex virus type 1, dif	90.79
d2ocpa1	241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	90.77
d1jnya3	224	Elongation factor eEF-1alpha, N-terminal (G) domai	90.38
d1u94a1	263	RecA protein, ATPase-domain {Escherichia coli [Tax	90.19
g1qhh.1	623	DEXX box DNA helicase {Bacillus stearothermophilus	90.14
d1tmka_	214	Thymidylate kinase {Baker's yeast (Saccharomyces c	89.39
d1wp9a1	200	putative ATP-dependent RNA helicase PF2015 {Pyroco	89.07
d1osna_	331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	88.96
d2jdia3	285	Central domain of alpha subunit of F1 ATP synthase	88.7
d1r5ba3	245	Eukaryotic peptide chain release factor ERF2, G do	88.48
d2p6ra3	202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	88.3
d1n0ua2	341	Elongation factor 2 (eEF-2), N-terminal (G) domain	88.11
d1yksa1	140	YFV helicase domain {Yellow fever virus [TaxId: 11	87.88
d1fx0a3	276	Central domain of alpha subunit of F1 ATP synthase	87.14
d2eyqa3	233	Transcription-repair coupling factor, TRCF {Escher	86.89
d1wb9a2	234	DNA repair protein MutS, the C-terminal domain {Es	86.4
d1gm5a3	264	RecG helicase domain {Thermotoga maritima [TaxId:	86.15
d1tuea_	205	Replication protein E1 helicase domain {Human papi	85.85
d1hyqa_	232	Cell division regulator MinD {Archaeon Archaeoglob	85.6
d1g3qa_	237	Cell division regulator MinD {Archaeon Pyrococcus	85.46
d1mo6a1	269	RecA protein, ATPase-domain {Mycobacterium tubercu	85.33
d1ewqa2	224	DNA repair protein MutS, the C-terminal domain {Th	84.54
d1u0ja_	267	Rep 40 protein helicase domain {Adeno-associated v	83.9
d1c9ka_	180	Adenosylcobinamide kinase/adenosylcobinamide phosp	83.81
d1deka_	241	Deoxynucleoside monophosphate kinase {Bacteriophag	83.74
d1gkub1	237	Helicase-like "domain" of reverse gyrase {Archaeon	83.69
d2olra1	313	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	82.47
d1g8fa3	122	ATP sulfurylase C-terminal domain {Baker's yeast (	82.46
d1w36b1	485	Exodeoxyribonuclease V beta chain (RecB), N-termin	82.11
d1j3ba1	318	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	81.92
d1xp8a1	268	RecA protein, ATPase-domain {Deinococcus radiodura	80.73
d2gnoa2	198	gamma subunit of DNA polymerase III, N-domain {The	80.46

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap1A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.33  E-value=7.7e-13  Score=74.42  Aligned_cols=44  Identities=30%  Similarity=0.371  Sum_probs=38.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      +.|||+++|++|||||||+.|      |..+.|...|.||++  +.+...+.
T Consensus         2 r~~KivvvG~~~vGKTsli~r------~~~~~f~~~~~~t~~--~~~~~~~~   45 (167)
T d1c1ya_           2 REYKLVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYRKQVE   45 (167)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH------HHHCCCCCSCCCCSE--EEEEEEEE
T ss_pred             ceeEEEEECCCCCCHHHHHHH------HHcCCCCCccCCccc--cccceeEE
Confidence            468999999999999999998      888999999999999  77766554

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoQ
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.33  E-value=4.8e-13  Score=76.60  Aligned_cols=48  Identities=42%  Similarity=0.645  Sum_probs=40.4

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ..+....+||+++|++|||||||+.|      |..+.|...+.||++  +++...+
T Consensus         3 ~~~~~~~~Ki~lvG~~~vGKTsLi~r------~~~~~f~~~~~~Ti~--~~~~~~~   50 (185)
T d2atxa1           3 HGPGALMLKCVVVGDGAVGKTCLLMS------YANDAFPEEYVPTVF--DHYAVSV   50 (185)
T ss_dssp             SCCEEEEEEEEEEECTTSSHHHHHHH------HHHSSCCCSCCCSSC--CCEEEEE
T ss_pred             CCCCCcEEEEEEECCCCCCHHHHHHH------HhhCCCCCcCCCcee--eeeeEEE
Confidence            34567789999999999999999998      888889999999988  6666544

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-like estrogen-regulated growth inhibitor, RERG
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=1.5e-12  Score=73.40  Aligned_cols=42  Identities=26%  Similarity=0.353  Sum_probs=36.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .+||+++|++|||||||+.|      |..+.|...|.||++  +.|....
T Consensus         2 eiKi~lvG~~~vGKTsli~r------~~~~~f~~~~~pTi~--~~~~~~~   43 (168)
T d2atva1           2 EVKLAIFGRAGVGKSALVVR------FLTKRFIWEYDPTLE--STYRHQA   43 (168)
T ss_dssp             CEEEEEECCTTSSHHHHHHH------HHHSCCCSCCCTTCC--EEEEEEE
T ss_pred             cEEEEEECCCCCCHHHHHHH------HHhCCCCCccCCcee--ccccccc
Confidence            47999999999999999998      888899999999998  6665443

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rac
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=2e-12  Score=73.63  Aligned_cols=45  Identities=40%  Similarity=0.620  Sum_probs=39.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ...+||+++|++|||||||+.|      |..+.|...+.||++  +.+.+.+.
T Consensus         3 p~~iKivviG~~~vGKTsli~~------~~~~~f~~~~~~ti~--~~~~~~~~   47 (183)
T d1mh1a_           3 PQAIKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYSANVM   47 (183)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHH------HHHSSCCSSCCCCSC--CEEEEEEE
T ss_pred             ceeEEEEEECCCCCCHHHHHHH------HHhCCCCccccccee--eceeeeee
Confidence            4568999999999999999998      888999999999998  77776543

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap2a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=1.8e-12  Score=72.74  Aligned_cols=44  Identities=30%  Similarity=0.375  Sum_probs=38.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ..+||+++|++|||||||+.|      |..+.|...+.||++  +++.....
T Consensus         2 k~~Ki~lvG~~~vGKTsLi~r------~~~~~f~~~~~~t~~--~~~~~~~~   45 (167)
T d1kaoa_           2 REYKVVVLGSGGVGKSALTVQ------FVTGTFIEKYDPTIE--DFYRKEIE   45 (167)
T ss_dssp             CEEEEEEECCTTSSHHHHHHH------HHHSCCCSCCCTTCC--EEEEEEEE
T ss_pred             ceeEEEEECCCCcCHHHHHHH------HHhCCCCCccCCcee--eeeeeeee
Confidence            368999999999999999998      888889999999998  77765543

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein RalA
species: Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]

Probab=99.28  E-value=1.8e-12  Score=73.19  Aligned_cols=44  Identities=30%  Similarity=0.376  Sum_probs=38.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ..+||+++|+++||||||+.|      |..+.|...|.||++  +.|...+.
T Consensus         3 ~~~KivlvG~~~vGKTsli~~------~~~~~f~~~~~~T~~--~~~~~~~~   46 (168)
T d1u8za_           3 ALHKVIMVGSGGVGKSALTLQ------FMYDEFVEDYEPTKA--DSYRKKVV   46 (168)
T ss_dssp             CEEEEEEECSTTSSHHHHHHH------HHHSCCCSCCCTTCC--EEEEEEEE
T ss_pred             ceeEEEEECCCCcCHHHHHHH------HHhCCCCcccCCccc--cccccccc
Confidence            358999999999999999998      888889999999998  77765543

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: di-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.27  E-value=2.6e-12  Score=72.21  Aligned_cols=42  Identities=29%  Similarity=0.376  Sum_probs=36.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .|||+++|++|||||||+.|      |..+.|...|.||++  +.+....
T Consensus         2 ~~Ki~viG~~~vGKTsLi~r------~~~~~f~~~~~~T~~--~~~~~~~   43 (171)
T d2erxa1           2 DYRVAVFGAGGVGKSSLVLR------FVKGTFRESYIPTVE--DTYRQVI   43 (171)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHTCCCCSSCCCCSC--EEEEEEE
T ss_pred             CeEEEEECCCCCCHHHHHHH------HHhCCCCCccCccee--eccccce
Confidence            58999999999999999998      888889999999998  6665443

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein RheB
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.25  E-value=3e-12  Score=71.84  Aligned_cols=44  Identities=20%  Similarity=0.281  Sum_probs=37.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ..+||+++|++|||||||+.|      |..+.|...+.||++  +.|...+.
T Consensus         3 k~~Kv~liG~~~vGKTsLl~~------~~~~~f~~~~~~t~~--~~~~~~~~   46 (167)
T d1xtqa1           3 KSRKIAILGYRSVGKSSLTIQ------FVEGQFVDSYDPTIE--NTFTKLIT   46 (167)
T ss_dssp             EEEEEEEEESTTSSHHHHHHH------HHHSCCCSCCCSSCC--EEEEEEEE
T ss_pred             cceEEEEECCCCcCHHHHHHH------HHhCCCCcccCccee--cccceEEe
Confidence            568999999999999999998      888889999999998  66655443

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.25  E-value=3.2e-12  Score=72.03  Aligned_cols=45  Identities=33%  Similarity=0.326  Sum_probs=38.2

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ..|||+++|+++||||||+.|      |..+.|...+.||.+  +.+...+.+
T Consensus         4 ~~~Ki~lvG~~~vGKTsLi~r------~~~~~f~~~~~~t~~--~~~~~~~~~   48 (171)
T d2erya1           4 EKYRLVVVGGGGVGKSALTIQ------FIQSYFVTDYDPTIE--DSYTKQCVI   48 (171)
T ss_dssp             CEEEEEEEECTTSSHHHHHHH------HHHSCCCSSCCTTCC--EEEEEEEEE
T ss_pred             cceEEEEECCCCCCHHHHHHH------HHhCCCCcccCcccc--cceeeeeee
Confidence            348999999999999999998      888888889999988  777665543

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab21
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.25  E-value=3.5e-12  Score=71.63  Aligned_cols=36  Identities=28%  Similarity=0.389  Sum_probs=33.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.|||+++|++|||||||+.|      |..+.|...+.||++
T Consensus         2 y~fKivlvG~~~vGKTsLi~r------~~~~~f~~~~~~t~~   37 (167)
T d1z08a1           2 YSFKVVLLGEGCVGKTSLVLR------YCENKFNDKHITTLG   37 (167)
T ss_dssp             EEEEEEEECCTTSCHHHHHHH------HHHCCCCSSCCCCCS
T ss_pred             ceEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc
Confidence            679999999999999999998      888889999999887

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ran
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.24  E-value=2e-12  Score=73.08  Aligned_cols=44  Identities=23%  Similarity=0.221  Sum_probs=33.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ..||++++|+++||||||+.|      |..+.|...|.||++ ++++...+
T Consensus         2 ~~~Ki~vvG~~~vGKTsli~~------~~~~~f~~~~~~Ti~-~~~~~~~~   45 (170)
T d1i2ma_           2 VQFKLVLVGDGGTGKTTFVKR------HLTGEFEKKYVATLG-VEVHPLVF   45 (170)
T ss_dssp             EEEEEEEEECTTSSHHHHHHT------TC-----CCEEEETT-EEEEEEEE
T ss_pred             eeEEEEEECCCCcCHHHHHHH------HHhCCCCccccccee-cccccccc
Confidence            468999999999999999998      999999999999998 56655543

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.24  E-value=4.1e-12  Score=71.88  Aligned_cols=47  Identities=34%  Similarity=0.391  Sum_probs=38.0

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ++...+||+++|+.+||||||+.|      |..+.|...+.||..  +.+...+.
T Consensus         2 ~~~~~~Kv~lvG~~~vGKTsLi~r------~~~~~f~~~~~~t~~--~~~~~~~~   48 (173)
T d2fn4a1           2 PPSETHKLVVVGGGGVGKSALTIQ------FIQSYFVSDYDPTIE--DSYTKICS   48 (173)
T ss_dssp             CSSCEEEEEEEECTTSSHHHHHHH------HHHSSCCSSCCTTCC--EEEEEEEE
T ss_pred             CCCCeEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc--cceeeEec
Confidence            345679999999999999999998      888888888888876  66655443

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.23  E-value=5.4e-12  Score=72.34  Aligned_cols=43  Identities=44%  Similarity=0.695  Sum_probs=37.2

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      .+||+++|++|||||||+.|      |..+.|..++.||++  +++.....
T Consensus         3 ~iKvvllG~~~vGKTSli~r------~~~~~f~~~~~~t~~--~~~~~~~~   45 (191)
T d2ngra_           3 TIKCVVVGDGAVGKTCLLIS------YTTNKFPSEYVPTVF--DNYAVTVM   45 (191)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEEEEE
T ss_pred             ceEEEEECCCCcCHHHHHHH------HHhCCCCCCcCCcee--eecceeEe
Confidence            58999999999999999998      888999999999998  66655443

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.23  E-value=2.7e-12  Score=72.62  Aligned_cols=47  Identities=13%  Similarity=0.173  Sum_probs=40.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEecC
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE   65 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i~~   65 (65)
                      .+|++++|++|||||||+.|      |..+.|++.+.++.. ++.....+.+||
T Consensus         2 e~KivllG~~~vGKTsl~~r------~~~~~~~t~~~~~~~-~~~~~~~~~i~D   48 (195)
T d1svsa1           2 EVKLLLLGAGESGKSTIVKQ------MKIIHEAGTGIVETH-FTFKDLHFKMFD   48 (195)
T ss_dssp             EEEEEEECSTTSSHHHHHHH------HHHHHSCCCSEEEEE-EEETTEEEEEEE
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhhCCCCCccEEEEE-EEeeeeeeeeec
Confidence            58999999999999999998      888888888888876 677777777776

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoA
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.22  E-value=5.8e-12  Score=71.30  Aligned_cols=42  Identities=40%  Similarity=0.467  Sum_probs=36.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ..||+++|++|||||||+.|      |..+.|...+.||++  +.+....
T Consensus         2 r~KivvvG~~~vGKTsLi~~------~~~~~f~~~~~~t~~--~~~~~~~   43 (177)
T d1kmqa_           2 RKKLVIVGDGACGKTCLLIV------NSKDQFPEVYVPTVF--ENYVADI   43 (177)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEEEE
T ss_pred             cEEEEEECCCCcCHHHHHHH------HHhCCCCCCcCCcee--eeccccc
Confidence            57999999999999999998      888889999999998  6655443

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: cH-p21 Ras protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.22  E-value=7.5e-12  Score=70.20  Aligned_cols=43  Identities=33%  Similarity=0.365  Sum_probs=37.3

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      .|||+++|+++||||||+.|      +..+.|...+.|+++  +.+.....
T Consensus         3 e~Ki~viG~~~vGKTsli~~------l~~~~~~~~~~~~~~--~~~~~~~~   45 (166)
T d1ctqa_           3 EYKLVVVGAGGVGKSALTIQ------LIQNHFVDEYDPTIE--DSYRKQVV   45 (166)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHCCCCCSCCCCSE--EEEEEEEE
T ss_pred             eeEEEEECCCCCCHHHHHHH------HHhCCCCCccCCccc--eeecccee
Confidence            58999999999999999998      888889999999998  66665544

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoE (RND3)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.22  E-value=5.4e-12  Score=71.95  Aligned_cols=43  Identities=35%  Similarity=0.492  Sum_probs=37.6

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      .+|++++|++|||||||+.|      |..+.|...|.||++  +.+.....
T Consensus         2 ~~KivliG~~~vGKTsli~r------~~~~~f~~~~~~t~~--~~~~~~~~   44 (179)
T d1m7ba_           2 KCKIVVVGDSQCGKTALLHV------FAKDCFPENYVPTVF--ENYTASFE   44 (179)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCSE--EEEEEEEE
T ss_pred             ceEEEEECCCCcCHHHHHHH------HHhCCCCCccCCcee--eccccccc
Confidence            47999999999999999998      889999999999998  66665544

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein M-Ras (XRas)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.21  E-value=7.4e-12  Score=70.66  Aligned_cols=43  Identities=33%  Similarity=0.366  Sum_probs=37.3

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      .|||+++|+++||||||+.|      |..+.|...+.||++  ++|.....
T Consensus         4 t~Ki~lvG~~~vGKTsll~~------~~~~~~~~~~~~t~~--~~~~~~~~   46 (169)
T d1x1ra1           4 TYKLVVVGDGGVGKSALTIQ------FFQKIFVPDYDPTIE--DSYLKHTE   46 (169)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHHSSCCTTCCTTCC--EEEEEEEE
T ss_pred             cEEEEEECCCCcCHHHHHHH------HHhCCCCcccCccee--eccccccc
Confidence            58999999999999999998      888888888999988  77766543

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab3a
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.18  E-value=1.6e-11  Score=69.07  Aligned_cols=44  Identities=25%  Similarity=0.342  Sum_probs=36.1

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +++.+||+++|++|||||||+.|      +..+.|...+.|+++ .+.+..
T Consensus         2 ~~~~~Ki~vvG~~~vGKTsLi~~------l~~~~~~~~~~~~~~-~~~~~~   45 (169)
T d3raba_           2 FDYMFKILIIGNSSVGKTSFLFR------YADDSFTPAFVSTVG-IDFKVK   45 (169)
T ss_dssp             CSEEEEEEEECSTTSSHHHHHHH------HHHSCCCSSCCCCCS-EEEEEE
T ss_pred             CCeEEEEEEECCCCcCHHHHHHH------HHcCCCCcccccccc-cceeeE
Confidence            56789999999999999999998      887888888888776 444443

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab30
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.18  E-value=1.2e-11  Score=69.55  Aligned_cols=45  Identities=24%  Similarity=0.245  Sum_probs=36.3

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +++.+|++++|+++||||||+.+      +..+.|...+.|+++ .+.+...
T Consensus         2 ~~~~~Ki~lvG~~~vGKTsLi~~------l~~~~f~~~~~~~~~-~~~~~~~   46 (171)
T d2ew1a1           2 YDFLFKIVLIGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFMIKT   46 (171)
T ss_dssp             CSEEEEEEEEESTTSSHHHHHHH------HHHSSCCTTCCCCCS-EEEEEEE
T ss_pred             CCEEEEEEEECCCCcCHHHHHHH------HHhCCCCCccccccc-ceEEEEE
Confidence            56789999999999999999997      888888887777775 3444443

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.15  E-value=8.1e-12  Score=70.82  Aligned_cols=38  Identities=26%  Similarity=0.372  Sum_probs=31.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+|++++|++|||||||+.|      |..+.|  .+.||+| ++...
T Consensus         2 e~Kiv~lG~~~vGKTsll~r------~~~~~~--~~~pTiG-~~~~~   39 (200)
T d2bcjq2           2 ELKLLLLGTGESGKSTFIKQ------MRIIHG--SGVPTTG-IIEYP   39 (200)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHHTS--SCCCCCS-CEEEE
T ss_pred             eeEEEEECCCCCCHHHHHHH------HhCCCC--CCCceee-EEEEE
Confidence            58999999999999999997      777766  4689998 55443

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab27b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.14  E-value=6e-11  Score=67.34  Aligned_cols=45  Identities=27%  Similarity=0.333  Sum_probs=37.1

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +++.+||+++|+.+||||||+.|      +..+.|...+.|+.+ .+.....
T Consensus         2 ~d~~~Ki~ivG~~~vGKTsLi~~------l~~~~~~~~~~~~~~-~~~~~~~   46 (186)
T d2f7sa1           2 YDYLIKLLALGDSGVGKTTFLYR------YTDNKFNPKFITTVG-IDFREKR   46 (186)
T ss_dssp             CSEEEEEEEESCTTSSHHHHHHH------HHCSCCCCEEEEEEE-EEEEEEE
T ss_pred             CCEEEEEEEECCCCcCHHHHHHH------HhcCCCCCccCCccc-ceeeEEE
Confidence            56789999999999999999998      888888888888887 4444433

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-22a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.14  E-value=2.9e-11  Score=67.78  Aligned_cols=36  Identities=25%  Similarity=0.363  Sum_probs=32.4

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+||+++|+++||||||+.|      +..+.|...+.||++
T Consensus         3 k~~Ki~lvG~~~vGKTsli~r------l~~~~f~~~~~~t~~   38 (167)
T d1z0ja1           3 RELKVCLLGDTGVGKSSIMWR------FVEDSFDPNINPTIG   38 (167)
T ss_dssp             EEEEEEEECCTTSSHHHHHHH------HHHSCCCTTCCCCCS
T ss_pred             ceeEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc
Confidence            468999999999999999998      888888888888877

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab14
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.13  E-value=3e-11  Score=67.65  Aligned_cols=38  Identities=21%  Similarity=0.373  Sum_probs=31.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++.+|++++|+++||||||+.|      +..+.|...+.|+.+
T Consensus         1 ~~y~~KivlvG~~~vGKTsli~~------~~~~~~~~~~~~~~~   38 (166)
T d1z0fa1           1 YSYIFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG   38 (166)
T ss_dssp             CSEEEEEEEECSTTSSHHHHHHH------HHHSCCCSSCTTSCC
T ss_pred             CcEEEEEEEECCCCcCHHHHHHH------HHhCCCCCccccccc
Confidence            36789999999999999999997      777777777666554

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ypt51
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.13  E-value=3.1e-11  Score=67.72  Aligned_cols=35  Identities=26%  Similarity=0.460  Sum_probs=32.5

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+.|||||||+.|      |..+.|...+.||++
T Consensus         3 ~iKi~vvG~~~vGKTsLi~~------~~~~~f~~~~~~t~~   37 (170)
T d1ek0a_           3 SIKLVLLGEAAVGKSSIVLR------FVSNDFAENKEPTIG   37 (170)
T ss_dssp             EEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCSS
T ss_pred             EEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc
Confidence            58999999999999999998      888889999999988

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab7
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.12  E-value=3.2e-11  Score=68.51  Aligned_cols=43  Identities=26%  Similarity=0.310  Sum_probs=35.8

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .+||+++|+++||||||+.+      +..+.|...|.||++ .+......
T Consensus         2 ~~Kv~vvG~~~vGKSSLi~~------l~~~~f~~~~~~t~~-~~~~~~~~   44 (184)
T d1vg8a_           2 LLKVIILGDSGVGKTSLMNQ------YVNKKFSNQYKATIG-ADFLTKEV   44 (184)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHHSCCCSSCCCCCS-EEEEEEEE
T ss_pred             EEEEEEECCCCcCHHHHHHH------HHhCCCCCCcCCccc-eeeeeeee
Confidence            58999999999999999998      888889999999987 34444433

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.12  E-value=2.6e-11  Score=67.81  Aligned_cols=42  Identities=29%  Similarity=0.300  Sum_probs=34.9

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      .+||+++|+++||||||+.|      |..+.|...+.||++ .+.+...
T Consensus         2 ~iKv~liG~~~vGKSsLi~r------l~~~~~~~~~~~ti~-~~~~~~~   43 (164)
T d1z2aa1           2 AIKMVVVGNGAVGKSSMIQR------YCKGIFTKDYKKTIG-VDFLERQ   43 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHH------HHHCCCCCCSSCCCS-SSEEEEE
T ss_pred             eEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc-cccceee
Confidence            47999999999999999998      888888888889887 4444433

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.12  E-value=1.9e-11  Score=68.96  Aligned_cols=39  Identities=28%  Similarity=0.398  Sum_probs=19.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+++.|||+++|+.+||||||+.+      +..+.|...+.||++
T Consensus         2 ~~~~~~Ki~vvG~~~vGKTsLi~~------l~~~~~~~~~~~t~~   40 (173)
T d2fu5c1           2 TYDYLFKLLLIGDSGVGKTCVLFR------FSEDAFNSTFISTIG   40 (173)
T ss_dssp             CCSEEEEEEEECCCCC----------------------CHHHHHC
T ss_pred             cccEEEEEEEECCCCcCHHHHHHH------HHhCCCCCccCcccc
Confidence            467889999999999999999997      888888888878876

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab4a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.11  E-value=5.3e-11  Score=66.98  Aligned_cols=38  Identities=21%  Similarity=0.256  Sum_probs=33.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++.+||+++|+.+||||||+.|      +..+.|...+.|+.+
T Consensus         2 ~~~~~KI~lvG~~~vGKTsll~~------~~~~~~~~~~~~t~~   39 (174)
T d2bmea1           2 YDFLFKFLVIGNAGTGKSCLLHQ------FIEKKFKDDSNHTIG   39 (174)
T ss_dssp             CSEEEEEEEEESTTSSHHHHHHH------HHHSSCCTTCCCCSE
T ss_pred             ccEEEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc
Confidence            57789999999999999999998      888888888888876

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.09  E-value=3.3e-11  Score=67.17  Aligned_cols=34  Identities=32%  Similarity=0.379  Sum_probs=31.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |||+++|+.|||||||+.|      |..+.|...+.|+++
T Consensus         1 fKv~vvG~~~vGKTsLi~r------~~~~~~~~~~~~~~~   34 (164)
T d1yzqa1           1 FKLVFLGEQSVGKTSLITR------FMYDSFDNTYQATIG   34 (164)
T ss_dssp             CEEEEEESTTSSHHHHHHH------HHHSCCCSSCCCCCS
T ss_pred             CEEEEECCCCcCHHHHHHH------HHhCCCCCcccccee
Confidence            6999999999999999998      888888888888887

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Ytp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.08  E-value=5.5e-11  Score=68.23  Aligned_cols=39  Identities=23%  Similarity=0.317  Sum_probs=34.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+++.+||+++|+.+||||||+.+      +..+.|...+.||++
T Consensus         2 ~~~~~~KivvvG~~~vGKTsli~~------l~~~~~~~~~~~t~~   40 (194)
T d2bcgy1           2 EYDYLFKLLLIGNSGVGKSCLLLR------FSDDTYTNDYISTIG   40 (194)
T ss_dssp             CCSEEEEEEEEESTTSSHHHHHHH------HHHCCCCTTCCCSSC
T ss_pred             CCCEEEEEEEECCCCcCHHHHHHH------HhhCCCCCCcCCccc
Confidence            467889999999999999999998      888888888888876

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab5a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.07  E-value=7.8e-11  Score=66.13  Aligned_cols=38  Identities=26%  Similarity=0.307  Sum_probs=33.7

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....|||+++|+.|||||||+.|      +..+.|...+.||.+
T Consensus         3 ~~~~~Ki~vvG~~~vGKTsLi~~------l~~~~f~~~~~~t~~   40 (170)
T d1r2qa_           3 KICQFKLVLLGESAVGKSSLVLR------FVKGQFHEFQESTIG   40 (170)
T ss_dssp             EEEEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCSS
T ss_pred             ceeEEEEEEECCCCcCHHHHHHH------HHhCCCCcccccccc
Confidence            34679999999999999999998      888888888888887

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab9a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.06  E-value=9.5e-11  Score=65.99  Aligned_cols=38  Identities=26%  Similarity=0.374  Sum_probs=30.0

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....|||+++|+++||||||+.|      +..+.|...+.+|++
T Consensus         3 ~~~~~KI~vvG~~~vGKSSli~~------~~~~~~~~~~~~t~~   40 (174)
T d1wmsa_           3 KSSLFKVILLGDGGVGKSSLMNR------YVTNKFDTQLFHTIG   40 (174)
T ss_dssp             CEEEEEEEEECCTTSSHHHHHHH------HHHSCCCC----CCS
T ss_pred             CCceEEEEEECCCCCCHHHHHHH------HHhCCCCCcccccee
Confidence            45679999999999999999997      888888888888876

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.06  E-value=5.3e-11  Score=66.55  Aligned_cols=42  Identities=24%  Similarity=0.369  Sum_probs=28.7

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      .+||+++|+++||||||+.+      +..+.|...+.||++ .+.....
T Consensus         2 ~~Ki~vvG~~~vGKTSli~~------l~~~~~~~~~~~t~~-~~~~~~~   43 (166)
T d1g16a_           2 IMKILLIGDSGVGKSCLLVR------FVEDKFNPSFITTIG-IDFKIKT   43 (166)
T ss_dssp             EEEEEEEESTTSSHHHHHHH------HHHCCCCC--------CCEEEEE
T ss_pred             EEEEEEECCCCcCHHHHHHH------HHhCCCCCccCCccc-eeEEEEE
Confidence            58999999999999999998      888888888889987 3444333

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab2b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.05  E-value=7.7e-11  Score=66.42  Aligned_cols=36  Identities=31%  Similarity=0.440  Sum_probs=27.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+||+++|+++||||||+.|      +..+.|...+.|+..
T Consensus         2 y~~KivvvG~~~vGKTsli~r------~~~~~~~~~~~~~~~   37 (173)
T d2a5ja1           2 YLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG   37 (173)
T ss_dssp             EEEEEEEESSTTSSHHHHHHH------HHHSCCCC-----CC
T ss_pred             eeEEEEEECCCCcCHHHHHHH------HhcCCCCCCccccee
Confidence            579999999999999999997      777777777766654

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-33b
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.05  E-value=7.8e-11  Score=65.59  Aligned_cols=35  Identities=29%  Similarity=0.411  Sum_probs=31.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+||+++|+.|||||||+.|      |..+.|...+.++.+
T Consensus         2 ~~Kv~liG~~~vGKTsLl~~------~~~~~~~~~~~~~~~   36 (165)
T d1z06a1           2 IFKIIVIGDSNVGKTCLTYR------FCAGRFPDRTEATIG   36 (165)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHHSSCCSSCCCCCS
T ss_pred             EEEEEEECCCCcCHHHHHHH------HHhCCCCCccCcccc
Confidence            58999999999999999998      888888888888776

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab11b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.05  E-value=9.5e-11  Score=66.12  Aligned_cols=38  Identities=26%  Similarity=0.404  Sum_probs=28.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++.+||+++|+.+||||||+.|      +..+.|...+.|+.+
T Consensus         1 ~~~~~Ki~vvG~~~vGKTsLi~~------~~~~~~~~~~~~~~~   38 (175)
T d2f9la1           1 YDYLFKVVLIGDSGVGKSNLLSR------FTRNEFNLESKSTIG   38 (175)
T ss_dssp             CSEEEEEEEESSTTSSHHHHHHH------HHHSCCCC---CCCS
T ss_pred             CCEEEEEEEECCCCcCHHHHHHH------HHhCCCCCccccccc
Confidence            36789999999999999999997      777777766665544

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.04  E-value=5.9e-11  Score=67.47  Aligned_cols=36  Identities=28%  Similarity=0.518  Sum_probs=30.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      .+|++++|+++||||||+.|      |   .|...+.||+| +...
T Consensus         2 ~iKivllG~~~vGKTsll~r------~---~f~~~~~pTiG-~~~~   37 (200)
T d1zcba2           2 LVKILLLGAGESGKSTFLKQ------M---RIIHGQDPTKG-IHEY   37 (200)
T ss_dssp             CEEEEEECSTTSSHHHHHHH------H---HHHHSCCCCSS-EEEE
T ss_pred             eEEEEEECCCCCCHHHHHHH------H---hcCCCCCCeee-eEEE
Confidence            58999999999999999997      6   36777899998 4433

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL8A [TaxId: 9606]

Probab=99.00  E-value=1.7e-10  Score=64.35  Aligned_cols=35  Identities=26%  Similarity=0.325  Sum_probs=31.8

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+++||||||+.+      +..+.|...+.||++
T Consensus         2 e~ki~i~G~~~~GKTsLl~~------l~~~~~~~~~~~T~~   36 (164)
T d1zd9a1           2 EMELTLVGLQYSGKTTFVNV------IASGQFNEDMIPTVG   36 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHH------HHHSCCCCSCCCCCS
T ss_pred             eEEEEEECCCCCCHHHHHHH------HHcCCCCCcccccce
Confidence            57999999999999999998      888888888889987

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab26
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.98  E-value=2.7e-10  Score=63.88  Aligned_cols=38  Identities=34%  Similarity=0.435  Sum_probs=29.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccc-cccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT-THVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~-~~~~ti~   52 (65)
                      ++..|||+++|+.+||||||+.|      +..+.|.. .+.++++
T Consensus         3 ~d~~fKi~vvG~~~vGKTsli~~------~~~~~~~~~~~~~~~~   41 (170)
T d2g6ba1           3 YDVAFKVMLVGDSGVGKTCLLVR------FKDGAFLAGTFISTVG   41 (170)
T ss_dssp             CSEEEEEEEECSTTSSHHHHHHH------HHHSCCCCCCCCCCCS
T ss_pred             CceEEEEEEECCCCcCHHHHHHH------HHhCCCCcccccceee
Confidence            67889999999999999999997      66666643 3344443

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein ypt7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.95  E-value=2.6e-10  Score=63.94  Aligned_cols=35  Identities=26%  Similarity=0.401  Sum_probs=28.5

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+||+++|+++||||||+.+      |..+.|...+.|+.+
T Consensus         2 ~~Ki~~vG~~~vGKSsLi~~------~~~~~~~~~~~~t~~   36 (175)
T d1ky3a_           2 ILKVIILGDSGVGKTSLMHR------YVNDKYSQQYKATIG   36 (175)
T ss_dssp             EEEEEEECCTTSSHHHHHHH------HHHSCCCTTC---CC
T ss_pred             eEEEEEECCCCcCHHHHHHH------HHcCCCCCccCcccc
Confidence            58999999999999999997      887888888887776

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.91  E-value=7.5e-10  Score=62.04  Aligned_cols=40  Identities=18%  Similarity=0.130  Sum_probs=24.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      |||+++|++|||||||+.+      |....+.. +.|+.+  +.|...+
T Consensus         2 fKi~lvG~~~vGKTsLi~~------~~~~~~~~-~~~~~~--~~~~~~i   41 (168)
T d2gjsa1           2 YKVLLLGAPGVGKSALARI------FGGVEDGP-EAEAAG--HTYDRSI   41 (168)
T ss_dssp             EEEEEECCTTSSHHHHHHH------HHTC----------C--EEEEEEE
T ss_pred             eEEEEECCCCcCHHHHHHH------HhCCccCC-cCCeee--eeeccee
Confidence            8999999999999999997      65554433 345555  5554433

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein GEM
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.87  E-value=8.1e-10  Score=62.20  Aligned_cols=44  Identities=18%  Similarity=0.214  Sum_probs=27.9

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccc-cccceEEEEeeEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT-THVPTVWAIDQYRIYK   61 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~-~~~~ti~~vd~~~~~~   61 (65)
                      ..|||+++|+.+||||||+.|      |....+.. .+.++++ ++++...+
T Consensus         2 ~~~Kv~lvG~~~vGKTsLi~~------~~~~~~~~~~~~~t~~-~~~~~~~~   46 (172)
T d2g3ya1           2 TYYRVVLIGEQGVGKSTLANI------FAGVHDSMDSDCEVLG-EDTYERTL   46 (172)
T ss_dssp             CEEEEEEECCTTSSHHHHHHH------HHCCCCTTCCC---CC-TTEEEEEE
T ss_pred             CEEEEEEECCCCcCHHHHHHH------HHhCcCCcccccccee-eecceeee
Confidence            469999999999999999997      65544332 2333443 34554433

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab18
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.87  E-value=1.5e-09  Score=61.15  Aligned_cols=37  Identities=19%  Similarity=0.322  Sum_probs=30.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+.+||||||+.|      +..+.|...+.++.+
T Consensus         5 ~~~iKi~vvG~~~vGKTsli~~------l~~~~~~~~~~~~~~   41 (177)
T d1x3sa1           5 LTTLKILIIGESGVGKSSLLLR------FTDDTFDPELAATIG   41 (177)
T ss_dssp             EEEEEEEEECSTTSSHHHHHHH------HHHSCCCTTCCCCCS
T ss_pred             cceeEEEEECCCCcCHHHHHHH------HHhCCCCCcccccee
Confidence            3568999999999999999997      777777776666554

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Centaurin gamma 1, G domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.86  E-value=1.7e-09  Score=61.37  Aligned_cols=41  Identities=24%  Similarity=0.236  Sum_probs=30.3

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      ..+|++++|+.+||||||+.+      |..+.|.. +.++.+  +.|...
T Consensus         4 p~~ki~vlG~~~vGKTsLi~~------~~~~~f~~-~~~t~~--~~~~~~   44 (175)
T d2bmja1           4 PELRLGVLGDARSGKSSLIHR------FLTGSYQV-LEKTES--EQYKKE   44 (175)
T ss_dssp             CEEEEEEECCTTTTHHHHHHH------HHHSCCCC-CCCSSC--EEEEEE
T ss_pred             CcEEEEEECCCCCCHHHHHHH------HHhCCCCC-cCCccc--eeEEEE
Confidence            358999999999999999997      77776654 345554  455443

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL2 [TaxId: 10090]

Probab=98.76  E-value=3.8e-09  Score=58.51  Aligned_cols=34  Identities=21%  Similarity=0.286  Sum_probs=26.9

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+.+||||||+.+      +..+.+ ..+.||++
T Consensus         2 ~~ki~ivG~~~~GKTsLi~~------l~~~~~-~~~~~t~~   35 (165)
T d1ksha_           2 ELRLLMLGLDNAGKTTILKK------FNGEDV-DTISPTLG   35 (165)
T ss_dssp             CEEEEEECSTTSSHHHHHHH------HTTCCC-SSCCCCSS
T ss_pred             cEEEEEECCCCCCHHHHHHH------HcCCCC-CcccceEe
Confidence            47999999999999999997      655544 34667765

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.67  E-value=4.6e-09  Score=61.36  Aligned_cols=33  Identities=15%  Similarity=0.233  Sum_probs=26.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|||||||+.|      +..+.    +.||+|
T Consensus         4 k~~~KilllG~~~vGKTsll~~------~~~~~----~~pTiG   36 (221)
T d1azta2           4 RATHRLLLLGAGESGKSTIVKQ------MRILH----VVLTSG   36 (221)
T ss_dssp             HHSEEEEEECSTTSSHHHHHHH------HHHHH----CCCCCS
T ss_pred             hhcCEEEEECCCCCCHHHHHHH------HhcCC----cCCCCC
Confidence            4568999999999999999997      65443    457776

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF1 [TaxId: 9606]

Probab=98.65  E-value=5.4e-09  Score=56.91  Aligned_cols=28  Identities=32%  Similarity=0.590  Sum_probs=22.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccccc
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTT   46 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~   46 (65)
                      +||+++|+++||||||+.|      +..+.|...
T Consensus         1 ikivlvG~~~vGKSsLi~~------l~~~~~~~~   28 (160)
T d1r8sa_           1 MRILMVGLDAAGKTTILYK------LKLGEIVTT   28 (160)
T ss_dssp             CEEEEECSTTSSHHHHHHH------HHHHCSSCC
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCcc
Confidence            4899999999999999997      555555443

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL3 [TaxId: 10090]

Probab=98.64  E-value=1.2e-08  Score=56.89  Aligned_cols=32  Identities=19%  Similarity=0.314  Sum_probs=25.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccc
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT   45 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~   45 (65)
                      .+...+||+++|+++||||||+.+      +..+.|..
T Consensus        12 ~~~~~~kI~vvG~~~vGKSsLi~~------l~~~~~~~   43 (176)
T d1fzqa_          12 APDQEVRILLLGLDNAGKTTLLKQ------LASEDISH   43 (176)
T ss_dssp             CCSSCEEEEEEESTTSSHHHHHHH------HCCSCCEE
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHH------HhcCCCCc
Confidence            345678999999999999999997      66665543

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.60  E-value=1.4e-08  Score=55.03  Aligned_cols=32  Identities=31%  Similarity=0.358  Sum_probs=25.2

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ||+++|+++||||||+.+      +..+.+. .+.||++
T Consensus         2 KI~liG~~nvGKSSLln~------l~~~~~~-~~~~t~~   33 (166)
T d2qtvb1           2 KLLFLGLDNAGKTTLLHM------LKNDRLA-TLQPTWH   33 (166)
T ss_dssp             EEEEECSTTSSHHHHHHH------HHHSCCC-CCCCCCS
T ss_pred             EEEEECCCCCCHHHHHHH------HhCCCCC-eeeceee
Confidence            899999999999999997      6655554 3566665

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]

Probab=98.59  E-value=1.5e-08  Score=56.69  Aligned_cols=29  Identities=28%  Similarity=0.460  Sum_probs=23.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccc
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT   45 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~   45 (65)
                      ..+|++++|+++||||||+.|      +..+.+..
T Consensus        11 k~~kIvlvG~~~vGKTSli~r------l~~~~~~~   39 (173)
T d1e0sa_          11 KEMRILMLGLDAAGKTTILYK------LKLGQSVT   39 (173)
T ss_dssp             CCEEEEEEEETTSSHHHHHHH------TTCCCCEE
T ss_pred             CeEEEEEECCCCCCHHHHHHH------HhcCCCCC
Confidence            458999999999999999997      66555544

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL1 [TaxId: 9606]

Probab=98.57  E-value=1.8e-08  Score=55.00  Aligned_cols=28  Identities=18%  Similarity=0.464  Sum_probs=23.2

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccc
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLT   45 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~   45 (65)
                      .+|++++|+++||||||+.+      +..+.|..
T Consensus         5 e~kI~ivG~~~vGKSSLi~~------~~~~~~~~   32 (169)
T d1upta_           5 EMRILILGLDGAGKTTILYR------LQVGEVVT   32 (169)
T ss_dssp             CEEEEEECSTTSSHHHHHHH------HHHSSCCC
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhCCCCcc
Confidence            48999999999999999997      65555544

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]

Probab=98.53  E-value=3.1e-08  Score=55.64  Aligned_cols=30  Identities=13%  Similarity=0.438  Sum_probs=24.3

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhcccccccccc
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLL   44 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~   44 (65)
                      ....+||+++|+++||||||+.+      +..+.+.
T Consensus        14 ~~k~~KI~lvG~~~vGKTsLi~~------l~~~~~~   43 (182)
T d1moza_          14 SNKELRILILGLDGAGKTTILYR------LQIGEVV   43 (182)
T ss_dssp             CSSCEEEEEEEETTSSHHHHHHH------TCCSEEE
T ss_pred             CCceEEEEEECCCCCCHHHHHHH------HhcCCCC
Confidence            34579999999999999999997      6555544

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=98.43  E-value=4.1e-08  Score=54.22  Aligned_cols=22  Identities=32%  Similarity=0.371  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....||+++|++|||||||+.+
T Consensus        11 ~k~~kI~lvG~~~vGKTsLl~~   32 (186)
T d1f6ba_          11 KKTGKLVFLGLDNAGKTTLLHM   32 (186)
T ss_dssp             TCCEEEEEEEETTSSHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHH
Confidence            3458999999999999999996

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL5A [TaxId: 9606]

Probab=98.39  E-value=1.4e-07  Score=52.18  Aligned_cols=21  Identities=29%  Similarity=0.463  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+||+++|+.|||||||+.|
T Consensus        14 k~~kI~vvG~~~~GKSsLi~r   34 (177)
T d1zj6a1          14 QEHKVIIVGLDNAGKTTILYQ   34 (177)
T ss_dssp             SCEEEEEEESTTSSHHHHHHH
T ss_pred             CeEEEEEECCCCCCHHHHHHH
Confidence            458999999999999999996

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.19  E-value=5.2e-07  Score=51.33  Aligned_cols=32  Identities=25%  Similarity=0.256  Sum_probs=23.9

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|+++|+.+||||||+.+      +..+.+...+ ||++
T Consensus         2 ~V~ivG~~~~GKTsLl~~------l~~~~~~~~~-~t~~   33 (207)
T d2fh5b1           2 AVLFVGLCDSGKTLLFVR------LLTGQYRDTQ-TSIT   33 (207)
T ss_dssp             EEEEECSTTSSHHHHHHH------HHHSCCCCBC-CCCS
T ss_pred             EEEEECCCCCCHHHHHHH------HHcCCCCccc-CCee
Confidence            689999999999999997      6555554433 4444

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable tRNA modification GTPase TrmE (MnmE), G domain
species: Escherichia coli [TaxId: 562]

Probab=97.99  E-value=6.6e-06  Score=44.65  Aligned_cols=19  Identities=37%  Similarity=0.634  Sum_probs=18.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +||+++|+++||||||+.+
T Consensus         2 ~kI~lvG~~nvGKSsLin~   20 (161)
T d2gj8a1           2 MKVVIAGRPNAGKSSLLNA   20 (161)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            7999999999999999985

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Thermotoga maritima [TaxId: 2336]

Probab=97.94  E-value=4e-06  Score=49.14  Aligned_cols=22  Identities=27%  Similarity=0.241  Sum_probs=18.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....++++|++|||||+.+.+
T Consensus         9 ~~p~vi~lvGptGvGKTTTiAK   30 (213)
T d1vmaa2           9 EPPFVIMVVGVNGTGKTTSCGK   30 (213)
T ss_dssp             SSCEEEEEECCTTSSHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHH
Confidence            4456788999999999999987

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=97.92  E-value=1.3e-05  Score=44.37  Aligned_cols=22  Identities=27%  Similarity=0.324  Sum_probs=19.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+..+|+++|.++||||||+.+
T Consensus         3 ~~~~~I~lvG~~~~GKSSLin~   24 (178)
T d1wf3a1           3 TYSGFVAIVGKPNVGKSTLLNN   24 (178)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHH
T ss_pred             ccCcEEEEECCCCCCHHHHHHH
Confidence            3456899999999999999985

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Escherichia coli [TaxId: 562]

Probab=97.91  E-value=2.1e-06  Score=47.20  Aligned_cols=24  Identities=17%  Similarity=0.383  Sum_probs=21.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.+..++|+++|.++||||||+.+
T Consensus        12 p~~~~~~I~lvG~~NvGKSSL~n~   35 (188)
T d1puia_          12 PSDTGIEVAFAGRSNAGKSSALNT   35 (188)
T ss_dssp             SCSCSEEEEEEECTTSSHHHHHTT
T ss_pred             CCccCCEEEEECCCCCCHHHHHHH
Confidence            456679999999999999999985

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.90  E-value=3e-06  Score=47.68  Aligned_cols=21  Identities=24%  Similarity=0.335  Sum_probs=18.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +...|+++|+++||||||+.+
T Consensus         2 ~~p~V~lvG~~n~GKTSLln~   22 (209)
T d1nrjb_           2 YQPSIIIAGPQNSGKTSLLTL   22 (209)
T ss_dssp             CCCEEEEECSTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            345899999999999999996

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hypothetical kinase-like protein Aq 1292
species: Aquifex aeolicus [TaxId: 63363]

Probab=97.89  E-value=3.3e-06  Score=46.43  Aligned_cols=19  Identities=37%  Similarity=0.688  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++++|++|+|||+|+..
T Consensus         1 ~ki~I~G~~G~GKSTLl~~   19 (178)
T d1ye8a1           1 MKIIITGEPGVGKTTLVKK   19 (178)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCcHHHHHHHH
Confidence            4899999999999999975

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=97.87  E-value=6e-06  Score=45.84  Aligned_cols=21  Identities=38%  Similarity=0.645  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+||.++|++++|||||+.+
T Consensus         7 ~~~kV~iiG~~~~GKSTLin~   27 (186)
T d1mkya2           7 DAIKVAIVGRPNVGKSTLFNA   27 (186)
T ss_dssp             SCEEEEEECSTTSSHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            468999999999999999985

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: TrmE GTPase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=97.77  E-value=3.2e-06  Score=45.94  Aligned_cols=19  Identities=37%  Similarity=0.690  Sum_probs=17.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +||+++|+++||||||+.+
T Consensus         1 ikI~liG~~n~GKSSLin~   19 (160)
T d1xzpa2           1 LRMVIVGKPNVGKSTLLNR   19 (160)
T ss_dssp             EEEEEECCHHHHTCHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5899999999999999986

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Transcriptional regulator NadR, ribosylnicotinamide kinase domain
species: Haemophilus influenzae [TaxId: 727]

Probab=97.75  E-value=8.9e-06  Score=44.20  Aligned_cols=21  Identities=19%  Similarity=0.306  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++.|++|+|||+|+.+
T Consensus         6 ~~K~I~i~G~~GsGKTTla~~   26 (192)
T d1lw7a2           6 FAKTVAILGGESSGKSVLVNK   26 (192)
T ss_dssp             TCEEEEEECCTTSHHHHHHHH
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            356899999999999999986

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Archaeon Acidianus ambivalens [TaxId: 2283]

Probab=97.64  E-value=1.2e-05  Score=46.98  Aligned_cols=20  Identities=20%  Similarity=0.177  Sum_probs=13.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-++++|++|||||+.+.+
T Consensus        12 p~vi~lvGptGvGKTTTiAK   31 (211)
T d1j8yf2          12 PYVIMLVGVQGTGKATTAGK   31 (211)
T ss_dssp             SEEEEEECSCCC----HHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            35577899999999999987

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Thermus aquaticus [TaxId: 271]

Probab=97.62  E-value=7.6e-06  Score=47.69  Aligned_cols=19  Identities=42%  Similarity=0.490  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|++|||||+.+.+
T Consensus         7 ~vi~lvGptGvGKTTTiaK   25 (207)
T d1okkd2           7 RVVLVVGVNGVGKTTTIAK   25 (207)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            3567899999999999987

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Thermus thermophilus [TaxId: 274]

Probab=97.61  E-value=2e-05  Score=43.67  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.++||||||+.+
T Consensus         3 ~VaivG~~nvGKSTLin~   20 (180)
T d1udxa2           3 DVGLVGYPNAGKSSLLAA   20 (180)
T ss_dssp             SEEEECCGGGCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Thermus aquaticus [TaxId: 271]

Probab=97.61  E-value=1.2e-05  Score=46.81  Aligned_cols=17  Identities=29%  Similarity=0.325  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|||||+.+.+
T Consensus        13 i~lvGp~GvGKTTTiaK   29 (207)
T d1ls1a2          13 WFLVGLQGSGKTTTAAK   29 (207)
T ss_dssp             EEEECCTTTTHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57789999999999987

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=97.60  E-value=0.00011  Score=40.14  Aligned_cols=22  Identities=27%  Similarity=0.306  Sum_probs=19.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.-.|+++|.++||||||+.+
T Consensus         3 ~~~~~I~iiG~~nvGKSSLin~   24 (179)
T d1egaa1           3 SYCGFIAIVGRPNVGKSTLLNK   24 (179)
T ss_dssp             CEEEEEEEECSSSSSHHHHHHH
T ss_pred             ccccEEEEECCCCCCHHHHHHH
Confidence            3556799999999999999985

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Bacillus subtilis [TaxId: 1423]

Probab=97.60  E-value=1.9e-05  Score=43.82  Aligned_cols=18  Identities=33%  Similarity=0.504  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.++||||||+.+
T Consensus         3 ~VaiiG~~nvGKSSLin~   20 (185)
T d1lnza2           3 DVGLVGFPSVGKSTLLSV   20 (185)
T ss_dssp             CEEEESSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999986

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Escherichia coli [TaxId: 562]

Probab=97.59  E-value=1.3e-05  Score=46.94  Aligned_cols=19  Identities=37%  Similarity=0.433  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++|++|||||+.+.+
T Consensus        10 ~vi~lvGptGvGKTTTiAK   28 (211)
T d2qy9a2          10 FVILMVGVNGVGKTTTIGK   28 (211)
T ss_dssp             EEEEEECCTTSCHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4678899999999999997

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]

Probab=97.57  E-value=1.7e-05  Score=42.91  Aligned_cols=20  Identities=35%  Similarity=0.416  Sum_probs=17.8

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..||++.|++|+|||+++.+
T Consensus         4 ~~~I~i~G~pGsGKTTia~~   23 (173)
T d1rkba_           4 LPNILLTGTPGVGKTTLGKE   23 (173)
T ss_dssp             CCCEEEECSTTSSHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            45899999999999999975

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Probable kinase LmjF30.1890
species: Leishmania major [TaxId: 5664]

Probab=97.56  E-value=2.5e-05  Score=42.44  Aligned_cols=21  Identities=19%  Similarity=0.352  Sum_probs=18.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++.|++|+|||++...
T Consensus         4 k~~~I~i~G~~GsGKTT~~~~   24 (174)
T d1y63a_           4 KGINILITGTPGTGKTSMAEM   24 (174)
T ss_dssp             SSCEEEEECSTTSSHHHHHHH
T ss_pred             CCCEEEEEeCCCCCHHHHHHH
Confidence            457999999999999999974

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Escherichia coli [TaxId: 562]

Probab=97.54  E-value=2.1e-05  Score=41.84  Aligned_cols=18  Identities=22%  Similarity=0.333  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|++|+|||++...
T Consensus         4 ~I~l~G~~GsGKSTvak~   21 (169)
T d1kaga_           4 NIFLVGPMGAGKSTIGRQ   21 (169)
T ss_dssp             CEEEECCTTSCHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            689999999999999974

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=97.52  E-value=2.6e-05  Score=42.80  Aligned_cols=18  Identities=33%  Similarity=0.589  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|+++|++++|||||+.+
T Consensus         2 ~V~liG~~n~GKSsLi~~   19 (171)
T d1mkya1           2 TVLIVGRPNVGKSTLFNK   19 (171)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            588999999999999986

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]

Probab=97.43  E-value=2.4e-05  Score=43.81  Aligned_cols=20  Identities=30%  Similarity=0.527  Sum_probs=18.0

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|.++|.+++|||||+.+
T Consensus        23 ~~~I~lvG~~n~GKSTLin~   42 (195)
T d1svia_          23 LPEIALAGRSNVGKSSFINS   42 (195)
T ss_dssp             CCEEEEEEBTTSSHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            35899999999999999985

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.43  E-value=3.9e-05  Score=43.09  Aligned_cols=17  Identities=29%  Similarity=0.530  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |+++||+|+||++|+.+
T Consensus         4 Ivl~GpsG~GK~tl~~~   20 (186)
T d1gkya_           4 IVISGPSGTGKSTLLKK   20 (186)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78999999999999985

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein engB
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=97.38  E-value=3.7e-05  Score=42.28  Aligned_cols=18  Identities=33%  Similarity=0.578  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|+++|.++||||||+.+
T Consensus         2 ~I~lvG~~nvGKSsLin~   19 (184)
T d2cxxa1           2 TIIFAGRSNVGKSTLIYR   19 (184)
T ss_dssp             EEEEEEBTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.36  E-value=5.2e-05  Score=42.62  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++||+|+||++|+.+
T Consensus         6 ivl~Gpsg~GK~tl~~~   22 (178)
T d1kgda_           6 LVLLGAHGVGRRHIKNT   22 (178)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78899999999999985

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.33  E-value=5.9e-05  Score=42.54  Aligned_cols=17  Identities=29%  Similarity=0.528  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |+++||+|+|||+|+.+
T Consensus         3 Ivl~GPsGsGK~tl~~~   19 (190)
T d1lvga_           3 VVLSGPSGAGKSTLLKK   19 (190)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78999999999999975

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Cancer-related NTPase, C1orf57
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.31  E-value=6.4e-05  Score=40.58  Aligned_cols=18  Identities=39%  Similarity=0.571  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++.|++|+|||+|+..
T Consensus         3 ~v~ItG~~GtGKTtl~~~   20 (189)
T d2i3ba1           3 HVFLTGPPGVGKTTLIHK   20 (189)
T ss_dssp             CEEEESCCSSCHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            478899999999999985

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein BH3686
species: Bacillus halodurans [TaxId: 86665]

Probab=97.31  E-value=6.6e-05  Score=40.27  Aligned_cols=18  Identities=22%  Similarity=0.359  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++.+
T Consensus         4 lI~i~G~~GsGKTTva~~   21 (176)
T d2bdta1           4 LYIITGPAGVGKSTTCKR   21 (176)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            378899999999999875

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.30  E-value=6.5e-05  Score=41.76  Aligned_cols=17  Identities=35%  Similarity=0.622  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++||+|+|||+++.+
T Consensus         5 ivl~GpsG~GK~tl~~~   21 (182)
T d1znwa1           5 VVLSGPSAVGKSTVVRC   21 (182)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67889999999999874

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=97.27  E-value=7.4e-05  Score=42.93  Aligned_cols=17  Identities=35%  Similarity=0.511  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++||+||||++|+.+
T Consensus         5 ivi~GPSG~GK~tl~~~   21 (205)
T d1s96a_           5 YIVSAPSGAGKSSLIQA   21 (205)
T ss_dssp             EEEECCTTSCHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67889999999999985

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Polynucleotide kinase, kinase domain
species: Bacteriophage T4 [TaxId: 10665]

Probab=97.25  E-value=8.5e-05  Score=39.60  Aligned_cols=17  Identities=18%  Similarity=0.280  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++.|++|+|||+++.+
T Consensus         5 Iii~G~pGsGKTTla~~   21 (152)
T d1ly1a_           5 ILTIGCPGSGKSTWARE   21 (152)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            67899999999999975

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Escherichia coli [TaxId: 562]

Probab=97.22  E-value=9.4e-05  Score=39.80  Aligned_cols=18  Identities=22%  Similarity=0.182  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|.+|+|||+|+.+
T Consensus         4 vi~itG~~GSGKTTL~~~   21 (170)
T d1np6a_           4 LLAFAAWSGTGKTTLLKK   21 (170)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            478899999999999986

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.20  E-value=8.3e-05  Score=40.72  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|.+|+|||++...
T Consensus         3 ~IvliG~~G~GKSTig~~   20 (165)
T d2iyva1           3 KAVLVGLPGSGKSTIGRR   20 (165)
T ss_dssp             SEEEECSTTSSHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            688999999999999864

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=97.18  E-value=0.00011  Score=43.18  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++|+||||||||+.+
T Consensus        97 t~~~~G~SGVGKSTLiN~  114 (225)
T d1u0la2          97 ISTMAGLSGVGKSSLLNA  114 (225)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHh
Confidence            468899999999999986

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Chloroplast protein translocon GTPase Toc34
species: Garden pea (Pisum sativum) [TaxId: 3888]

Probab=97.15  E-value=0.00034  Score=41.16  Aligned_cols=21  Identities=24%  Similarity=0.453  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++|+++|.+|+||||++..
T Consensus        31 ~~l~I~LvG~tg~GKSSliN~   51 (257)
T d1h65a_          31 NSLTILVMGKGGVGKSSTVNS   51 (257)
T ss_dssp             CEEEEEEEESTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCcHHHHHHH
Confidence            458999999999999999985

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ATP sulfurylase C-terminal domain
domain: ATP sulfurylase C-terminal domain
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=97.13  E-value=0.00021  Score=38.38  Aligned_cols=21  Identities=19%  Similarity=0.186  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+-|++.|.+|+|||++...
T Consensus         5 ~g~~I~l~G~~GsGKTTia~~   25 (183)
T d1m8pa3           5 QGFTIFLTGYMNSGKDAIARA   25 (183)
T ss_dssp             CCEEEEEECSTTSSHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            446788999999999999864

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=97.10  E-value=0.00015  Score=41.86  Aligned_cols=19  Identities=32%  Similarity=0.565  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++++|++|||||+++..
T Consensus        44 ~n~lLvG~pGVGKTalv~~   62 (195)
T d1jbka_          44 NNPVLIGEPGVGKTAIVEG   62 (195)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             CCeEEEecCCcccHHHHHH
Confidence            3689999999999999975

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=97.09  E-value=0.00016  Score=39.59  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|++|+|||+++..
T Consensus         1 m~I~i~G~pGSGKsT~a~~   19 (182)
T d1zina1           1 MNLVLMGLPGAGKGTQAEK   19 (182)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3789999999999999974

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]

Probab=97.08  E-value=0.00023  Score=40.03  Aligned_cols=22  Identities=18%  Similarity=0.424  Sum_probs=19.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|+.|+|||++..+
T Consensus         4 ~r~mrIiliG~PGSGKtT~a~~   25 (189)
T d2ak3a1           4 ARLLRAAIMGAPGSGKGTVSSR   25 (189)
T ss_dssp             SCCCEEEEECCTTSSHHHHHHH
T ss_pred             CcceeEEEECCCCCCHHHHHHH
Confidence            3567999999999999999985

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=97.08  E-value=0.00015  Score=43.48  Aligned_cols=19  Identities=32%  Similarity=0.499  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++++|++|||||+++..
T Consensus        40 ~n~lLVG~~GvGKTalv~~   58 (268)
T d1r6bx2          40 NNPLLVGESGVGKTAIAEG   58 (268)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CCcEEECCCCCcHHHHHHH
Confidence            4789999999999999985

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Gluconate kinase
domain: Gluconate kinase
species: Escherichia coli [TaxId: 562]

Probab=97.06  E-value=0.00017  Score=38.95  Aligned_cols=19  Identities=21%  Similarity=0.329  Sum_probs=15.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++.+
T Consensus         7 ~iivl~G~~GsGKsT~a~~   25 (171)
T d1knqa_           7 HIYVLMGVSGSGKSAVASE   25 (171)
T ss_dssp             EEEEEECSTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3456789999999999985

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=97.05  E-value=0.00016  Score=43.66  Aligned_cols=19  Identities=32%  Similarity=0.504  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      --++++||+|||||.|+..
T Consensus        50 ~~iLl~GPpG~GKT~lAka   68 (309)
T d1ofha_          50 KNILMIGPTGVGKTEIARR   68 (309)
T ss_dssp             CCEEEECCTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4578999999999999975

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]

Probab=97.05  E-value=0.00019  Score=39.84  Aligned_cols=20  Identities=25%  Similarity=0.308  Sum_probs=17.9

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++++|++|+|||++..+
T Consensus         3 ~~riil~G~pGSGKsT~a~~   22 (190)
T d1ak2a1           3 GVRAVLLGPPGAGKGTQAPK   22 (190)
T ss_dssp             CCEEEEECCTTSSHHHHHHH
T ss_pred             ccEEEEECCCCCCHHHHHHH
Confidence            46899999999999999985

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Archaeal ATPase SSO1545
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=97.05  E-value=0.00013  Score=41.70  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|+.+
T Consensus        31 ~i~i~G~~G~GKTsLl~~   48 (283)
T d2fnaa2          31 ITLVLGLRRTGKSSIIKI   48 (283)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEcCCCCcHHHHHHH
Confidence            467889999999999985

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.04  E-value=0.0002  Score=39.50  Aligned_cols=19  Identities=16%  Similarity=0.387  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|+.|+|||++..+
T Consensus         1 m~I~i~G~pGsGKsT~a~~   19 (181)
T d2cdna1           1 MRVLLLGPPGAGKGTQAVK   19 (181)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4799999999999999985

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
domain: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
species: Streptococcus pyogenes [TaxId: 1314]

Probab=97.03  E-value=0.00028  Score=40.48  Aligned_cols=19  Identities=32%  Similarity=0.394  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        33 ~~ilL~GpPGtGKT~la~~   51 (273)
T d1gvnb_          33 TAFLLGGQPGSGKTSLRSA   51 (273)
T ss_dssp             EEEEEECCTTSCTHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            3488999999999999975

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermus thermophilus [TaxId: 274]

Probab=97.02  E-value=0.00017  Score=41.32  Aligned_cols=19  Identities=26%  Similarity=0.410  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.||+|+|||+++..
T Consensus        36 ~~~Ll~GPpG~GKTtla~~   54 (239)
T d1ixsb2          36 EHLLLFGPPGLGKTTLAHV   54 (239)
T ss_dssp             CCEEEECCTTSCHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4588999999999999974

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]

Probab=96.99  E-value=0.00018  Score=41.16  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||+|+|||+++..
T Consensus        37 ~~L~~GPpGtGKT~lA~~   54 (238)
T d1in4a2          37 HVLLAGPPGLGKTTLAHI   54 (238)
T ss_dssp             CEEEESSTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            588999999999999974

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=96.98  E-value=0.00017  Score=45.77  Aligned_cols=20  Identities=30%  Similarity=0.441  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++++||+|||||-|+.+
T Consensus        49 ksNILliGPTGvGKTlLAr~   68 (443)
T d1g41a_          49 PKNILMIGPTGVGKTEIARR   68 (443)
T ss_dssp             CCCEEEECCTTSSHHHHHHH
T ss_pred             cccEEEECCCCCCHHHHHHH
Confidence            34799999999999999985

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=96.98  E-value=0.00019  Score=42.52  Aligned_cols=18  Identities=33%  Similarity=0.654  Sum_probs=15.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~liGpnGaGKSTll~~   43 (240)
T d2onka1          26 YCVLLGPTGAGKSVFLEL   43 (240)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            356889999999999973

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Campylobacter jejuni [TaxId: 197]

Probab=96.96  E-value=0.00021  Score=39.13  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|.+|+|||++...
T Consensus         2 ~I~liG~~GsGKsTi~k~   19 (161)
T d1viaa_           2 NIVFIGFMGSGKSTLARA   19 (161)
T ss_dssp             CEEEECCTTSCHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            588999999999999875

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.96  E-value=0.00022  Score=42.27  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus        42 ~vaivG~sGsGKSTLl~l   59 (251)
T d1jj7a_          42 VTALVGPNGSGKSTVAAL   59 (251)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            578999999999999973

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Dictyostelium discoideum [TaxId: 44689]

Probab=96.96  E-value=0.00025  Score=39.38  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|+++|++|+|||+++.+
T Consensus         7 ~iI~i~G~pGSGKsT~a~~   25 (194)
T d1qf9a_           7 NVVFVLGGPGSGKGTQCAN   25 (194)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5678899999999999985

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus globisporus [TaxId: 1459]

Probab=96.96  E-value=0.00024  Score=39.21  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|+.|+|||+++.+
T Consensus         1 M~I~i~G~pGSGKsT~a~~   19 (182)
T d1s3ga1           1 MNIVLMGLPGAGKGTQADR   19 (182)
T ss_dssp             CEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3799999999999999975

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=96.95  E-value=0.0002  Score=42.09  Aligned_cols=16  Identities=19%  Similarity=0.532  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +.++|++|+|||+|+.
T Consensus        34 ~~iiG~sGsGKSTLl~   49 (230)
T d1l2ta_          34 VSIMGPSGSGKSTMLN   49 (230)
T ss_dssp             EEEECSTTSSHHHHHH
T ss_pred             EEEECCCCCCcchhhH
Confidence            6789999999999986

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=96.91  E-value=0.00026  Score=41.77  Aligned_cols=18  Identities=28%  Similarity=0.339  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus        31 ~vaIvG~sGsGKSTLl~l   48 (241)
T d2pmka1          31 VIGIVGRSGSGKSTLTKL   48 (241)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Maize (Zea mays) [TaxId: 4577]

Probab=96.91  E-value=0.00016  Score=40.17  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|++.|+.|+|||+++.+
T Consensus         4 m~I~i~GppGsGKsT~a~~   22 (189)
T d1zaka1           4 LKVMISGAPASGKGTQCEL   22 (189)
T ss_dssp             CCEEEEESTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5799999999999999975

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpX
species: Helicobacter pylori [TaxId: 210]

Probab=96.91  E-value=0.00022  Score=44.20  Aligned_cols=20  Identities=25%  Similarity=0.360  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-.++++||+|||||-|+.+
T Consensus        68 ~~niLfiGPTGvGKTElAk~   87 (364)
T d1um8a_          68 KSNILLIGPTGSGKTLMAQT   87 (364)
T ss_dssp             CCCEEEECCTTSSHHHHHHH
T ss_pred             CcceeeeCCCCccHHHHHHH
Confidence            35699999999999999875

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter LmrA, C-terminal domain
species: Lactococcus lactis [TaxId: 1358]

Probab=96.90  E-value=0.00027  Score=41.64  Aligned_cols=18  Identities=17%  Similarity=0.289  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus        30 ~vaivG~sGsGKSTLl~l   47 (242)
T d1mv5a_          30 IIAFAGPSGGGKSTIFSL   47 (242)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=96.90  E-value=0.00025  Score=41.81  Aligned_cols=17  Identities=35%  Similarity=0.534  Sum_probs=15.0

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        28 i~~liGpsGsGKSTLl~   44 (232)
T d2awna2          28 FVVFVGPSGCGKSTLLR   44 (232)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            36789999999999996

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter PF0895
species: Pyrococcus furiosus [TaxId: 2261]

Probab=96.90  E-value=0.00025  Score=40.58  Aligned_cols=16  Identities=31%  Similarity=0.459  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +.++|++|+|||+|+.
T Consensus        30 ~~l~G~NGsGKSTLl~   45 (200)
T d1sgwa_          30 VNFHGPNGIGKTTLLK   45 (200)
T ss_dssp             EEEECCTTSSHHHHHH
T ss_pred             EEEECCCCChHHHHHH
Confidence            6789999999999997

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.90  E-value=0.00025  Score=38.67  Aligned_cols=16  Identities=44%  Similarity=0.472  Sum_probs=14.7

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      .++|.+|+|||+|+.+
T Consensus         5 ~I~G~~gSGKTTli~~   20 (165)
T d1xjca_           5 QVVGYKHSGKTTLMEK   20 (165)
T ss_dssp             EEECCTTSSHHHHHHH
T ss_pred             EEEeCCCCCHHHHHHH
Confidence            4899999999999986

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=96.89  E-value=0.0003  Score=40.06  Aligned_cols=19  Identities=21%  Similarity=0.371  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+++..
T Consensus        44 ~~lll~GppGtGKT~l~~~   62 (276)
T d1fnna2          44 PRATLLGRPGTGKTVTLRK   62 (276)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             CceEEECCCCCCHHHHHHH
Confidence            4688999999999999974

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.88  E-value=0.00032  Score=38.76  Aligned_cols=19  Identities=21%  Similarity=0.396  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+.|+|||++...
T Consensus         3 mrIvl~G~pGSGKtT~a~~   21 (180)
T d1akya1           3 IRMVLIGPPGAGKGTQAPN   21 (180)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5899999999999999985

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Bacillus subtilis [TaxId: 1423]

Probab=96.85  E-value=9.2e-05  Score=43.75  Aligned_cols=18  Identities=39%  Similarity=0.641  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++|+||||||||+.+
T Consensus        99 ~~vl~G~SGVGKSSLiN~  116 (231)
T d1t9ha2          99 TTVFAGQSGVGKSSLLNA  116 (231)
T ss_dssp             EEEEEESHHHHHHHHHHH
T ss_pred             eEEEECCCCccHHHHHHh
Confidence            467899999999999985

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=96.84  E-value=0.0003  Score=41.82  Aligned_cols=17  Identities=35%  Similarity=0.458  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      ++.++|++|+|||+|+.
T Consensus        46 ~vaivG~sGsGKSTLl~   62 (255)
T d2hyda1          46 TVAFVGMSGGGKSTLIN   62 (255)
T ss_dssp             EEEEECSTTSSHHHHHT
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            57899999999999996

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter MsbA, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

Probab=96.84  E-value=0.00025  Score=42.03  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus        43 ~iaivG~sGsGKSTLl~l   60 (253)
T d3b60a1          43 TVALVGRSGSGKSTIASL   60 (253)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            578999999999999973

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein Atu3015
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=96.83  E-value=0.00026  Score=38.14  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++.|++|+|||+++..
T Consensus         7 I~l~G~~GsGKSTia~~   23 (176)
T d1zp6a1           7 LLLSGHPGSGKSTIAEA   23 (176)
T ss_dssp             EEEEECTTSCHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            66889999999999864

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Escherichia coli [TaxId: 562]

Probab=96.83  E-value=0.00028  Score=38.79  Aligned_cols=19  Identities=16%  Similarity=0.316  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++++|+.|+|||+...+
T Consensus         1 m~I~i~G~pGSGKsT~~~~   19 (179)
T d1e4va1           1 MRIILLGAPVAGKGTQAQF   19 (179)
T ss_dssp             CEEEEEESTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4799999999999999874

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.82  E-value=0.00036  Score=38.79  Aligned_cols=20  Identities=30%  Similarity=0.310  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-++++|.+|+|||+++.+
T Consensus        14 p~liil~G~pGsGKST~a~~   33 (172)
T d1yj5a2          14 PEVVVAVGFPGAGKSTFIQE   33 (172)
T ss_dssp             CCEEEEECCTTSSHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            45788999999999999986

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Chloramphenicol phosphotransferase
domain: Chloramphenicol phosphotransferase
species: Streptomyces venezuelae [TaxId: 54571]

Probab=96.81  E-value=0.00037  Score=37.37  Aligned_cols=17  Identities=18%  Similarity=0.501  Sum_probs=14.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++.|++|+|||+++..
T Consensus         6 I~l~G~~GsGKsTva~~   22 (178)
T d1qhxa_           6 IILNGGSSAGKSGIVRC   22 (178)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            45569999999999975

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=96.81  E-value=0.0003  Score=38.16  Aligned_cols=18  Identities=33%  Similarity=0.578  Sum_probs=14.9

Q ss_pred             EE-EEECCCCChHHHHHhH
Q psy15257         14 KC-VVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kv-v~lG~~gvGKTsl~~~   31 (65)
                      |+ ++.|..|+|||+++..
T Consensus         2 kiivi~G~~GsGKTT~~~~   20 (194)
T d1nksa_           2 KIGIVTGIPGVGKSTVLAK   20 (194)
T ss_dssp             EEEEEEECTTSCHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            55 4579999999999975

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=96.80  E-value=0.00033  Score=41.44  Aligned_cols=17  Identities=29%  Similarity=0.423  Sum_probs=15.2

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        34 ~~~liGpsGaGKSTLl~   50 (239)
T d1v43a3          34 FLVLLGPSGCGKTTTLR   50 (239)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCChHHHHHH
Confidence            36789999999999997

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6-like protein APE0152, N-terminal domain
species: Aeropyrum pernix [TaxId: 56636]

Probab=96.79  E-value=0.00038  Score=39.84  Aligned_cols=17  Identities=29%  Similarity=0.362  Sum_probs=14.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.||+|+|||+++..
T Consensus        49 l~l~GppGtGKT~l~~~   65 (287)
T d1w5sa2          49 YGSIGRVGIGKTTLAKF   65 (287)
T ss_dssp             EECTTCCSSSHHHHHHH
T ss_pred             EEeECCCCCCHHHHHHH
Confidence            45569999999999975

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.78  E-value=0.00049  Score=38.10  Aligned_cols=19  Identities=21%  Similarity=0.326  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|++|+|||+.+.+
T Consensus         2 ~iI~i~GppGSGKsT~a~~   20 (194)
T d1teva_           2 LVVFVLGGPGAGKGTQCAR   20 (194)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5789999999999999875

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=96.78  E-value=0.0004  Score=37.47  Aligned_cols=18  Identities=33%  Similarity=0.267  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|++.|+.|+|||+++.+
T Consensus         3 iI~i~G~~GsGKsT~~~~   20 (190)
T d1khta_           3 VVVVTGVPGVGSTTSSQL   20 (190)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367789999999999975

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor SelB, N-terminal domain
species: Methanococcus maripaludis [TaxId: 39152]

Probab=96.77  E-value=0.00056  Score=37.78  Aligned_cols=21  Identities=24%  Similarity=0.259  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|.++|..++|||||+.+
T Consensus         4 k~inIaiiG~~naGKSTL~n~   24 (179)
T d1wb1a4           4 KNINLGIFGHIDHGKTTLSKV   24 (179)
T ss_dssp             EEEEEEEEECTTSSHHHHHHH
T ss_pred             CCEEEEEEeCCCCcHHHHHHH
Confidence            567999999999999999985

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-inducible GTPase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.76  E-value=0.00084  Score=41.81  Aligned_cols=21  Identities=29%  Similarity=0.561  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++|.++|.+|+|||||+..
T Consensus        55 ~~l~Iai~G~~n~GKSSLiNa   75 (400)
T d1tq4a_          55 SVLNVAVTGETGSGKSSFINT   75 (400)
T ss_dssp             CCEEEEEEECTTSSHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            358999999999999999985

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.75  E-value=0.00031  Score=42.21  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|++|+|||+|+.-
T Consensus        64 ~vaivG~nGsGKSTLl~~   81 (281)
T d1r0wa_          64 MLAITGSTGSGKTSLLML   81 (281)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            478999999999999973

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Erwinia chrysanthemi [TaxId: 556]

Probab=96.75  E-value=0.00043  Score=37.90  Aligned_cols=18  Identities=22%  Similarity=0.235  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|+++|.+|+|||++...
T Consensus         4 ~Iil~G~~GsGKSTia~~   21 (170)
T d1e6ca_           4 PIFMVGARGCGMTTVGRE   21 (170)
T ss_dssp             CEEEESCTTSSHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            367889999999999875

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.72  E-value=0.00041  Score=39.71  Aligned_cols=19  Identities=21%  Similarity=0.310  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.||+|+|||+++..
T Consensus        53 ~~lll~GPpG~GKTt~a~~   71 (253)
T d1sxja2          53 RAAMLYGPPGIGKTTAAHL   71 (253)
T ss_dssp             SEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            3588999999999999974

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]

Probab=96.72  E-value=0.00031  Score=41.55  Aligned_cols=16  Identities=38%  Similarity=0.584  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +.++|++|+|||+|+.
T Consensus        34 ~~iiG~sGsGKSTLl~   49 (240)
T d3dhwc1          34 YGVIGASGAGKSTLIR   49 (240)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999996

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=96.69  E-value=0.00034  Score=41.14  Aligned_cols=17  Identities=35%  Similarity=0.534  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        29 ~~liGpsGaGKSTll~~   45 (229)
T d3d31a2          29 FVILGPTGAGKTLFLEL   45 (229)
T ss_dssp             EEEECCCTHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67899999999999973

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=96.67  E-value=0.00045  Score=40.80  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~liG~sGaGKSTll~~   48 (240)
T d1g2912          31 FMILLGPSGCGKTTTLRM   48 (240)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            367899999999999963

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=96.66  E-value=0.00054  Score=37.89  Aligned_cols=19  Identities=37%  Similarity=0.293  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-|+++|.+|+|||+++.+
T Consensus         3 ~li~l~GlpgsGKSTla~~   21 (213)
T d1bifa1           3 TLIVMVGLPARGKTYISKK   21 (213)
T ss_dssp             EEEEEECCTTSSHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4578999999999999985

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]

Probab=96.64  E-value=0.00055  Score=38.70  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|+.|+|||+|+.+
T Consensus         2 vi~v~G~~GsGKTTLl~~   19 (244)
T d1yrba1           2 IVVFVGTAGSGKTTLTGE   19 (244)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEEcCCCCcHHHHHHH
Confidence            478999999999999986

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=96.62  E-value=0.00055  Score=40.09  Aligned_cols=20  Identities=35%  Similarity=0.474  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.||+|+|||+++..
T Consensus        40 ~~~vLL~GppGtGKT~la~a   59 (246)
T d1d2na_          40 LVSVLLEGPPHSGKTALAAK   59 (246)
T ss_dssp             EEEEEEECSTTSSHHHHHHH
T ss_pred             CeEEEEECcCCCCHHHHHHH
Confidence            35689999999999999975

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=96.62  E-value=0.00053  Score=38.98  Aligned_cols=18  Identities=33%  Similarity=0.409  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||+|+|||+++..
T Consensus        47 ~lll~Gp~G~GKTtla~~   64 (231)
T d1iqpa2          47 HLLFAGPPGVGKTTAALA   64 (231)
T ss_dssp             EEEEESCTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            488999999999999974

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Uridylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.61  E-value=0.0006  Score=37.88  Aligned_cols=19  Identities=21%  Similarity=0.200  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      --++++|++|+|||+++.+
T Consensus         9 ~iI~i~GppGSGKsT~a~~   27 (196)
T d1ukza_           9 SVIFVLGGPGAGKGTQCEK   27 (196)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4578889999999999985

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.57  E-value=0.00041  Score=37.97  Aligned_cols=21  Identities=24%  Similarity=0.218  Sum_probs=17.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|++.|.+|+|||++...
T Consensus        18 ~g~vI~L~G~pGSGKTTiAk~   38 (195)
T d1x6va3          18 RGCTVWLTGLSGAGKTTVSMA   38 (195)
T ss_dssp             CCEEEEEESSCHHHHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            345678899999999999975

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=96.55  E-value=0.00031  Score=43.95  Aligned_cols=19  Identities=32%  Similarity=0.565  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++++|++|||||+++..
T Consensus        44 ~n~llvG~~GvGKtaiv~~   62 (387)
T d1qvra2          44 NNPVLIGEPGVGKTAIVEG   62 (387)
T ss_dssp             CCCEEEECTTSCHHHHHHH
T ss_pred             CCCeEECCCCCCHHHHHHH
Confidence            3578999999999999863

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.53  E-value=0.00065  Score=38.73  Aligned_cols=18  Identities=22%  Similarity=0.305  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||.|+|||+++..
T Consensus        35 ~lll~Gp~G~GKTt~~~~   52 (252)
T d1sxje2          35 HLLLYGPNGTGKKTRCMA   52 (252)
T ss_dssp             CEEEECSTTSSHHHHHHT
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999974

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Glucose transport protein GlcV, N-terminal domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=96.47  E-value=0.00039  Score=41.20  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~iiG~sGsGKSTll~~   50 (242)
T d1oxxk2          33 RFGILGPSGAGKTTFMRI   50 (242)
T ss_dssp             EEEEECSCHHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999973

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein PH0525
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=96.46  E-value=0.0026  Score=37.83  Aligned_cols=19  Identities=37%  Similarity=0.564  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +||-++|-++||||||+.+
T Consensus         1 ~~v~lvG~pn~GKStlfn~   19 (319)
T d1wxqa1           1 MEIGVVGKPNVGKSTFFSA   19 (319)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             CcEeEECCCCCCHHHHHHH
Confidence            4789999999999999985

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.46  E-value=0.00078  Score=38.06  Aligned_cols=18  Identities=33%  Similarity=0.421  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||+|+|||+++..
T Consensus        35 ~lll~Gp~G~GKTtl~~~   52 (237)
T d1sxjd2          35 HMLFYGPPGTGKTSTILA   52 (237)
T ss_dssp             CEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCChHHHHHH
Confidence            378999999999999874

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.43  E-value=0.00083  Score=38.07  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||+|+|||+++..
T Consensus        38 ~~ll~Gp~G~GKTt~a~~   55 (224)
T d1sxjb2          38 HMIISGMPGIGKTTSVHC   55 (224)
T ss_dssp             CEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCchhhHHH
Confidence            478999999999999863

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=96.37  E-value=0.0015  Score=39.40  Aligned_cols=19  Identities=32%  Similarity=0.422  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++||+|||||.|+..
T Consensus        53 ~~~lf~Gp~GvGKT~lak~   71 (315)
T d1r6bx3          53 GSFLFAGPTGVGKTEVTVQ   71 (315)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             eEEEEECCCcchhHHHHHH
Confidence            3678999999999999975

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=96.36  E-value=0.00061  Score=38.28  Aligned_cols=19  Identities=16%  Similarity=0.333  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++|.+-||+|+||||...+
T Consensus         4 i~IaIdGp~GsGKgT~ak~   22 (223)
T d1q3ta_           4 IQIAIDGPASSGKSTVAKI   22 (223)
T ss_dssp             CEEEEECSSCSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4566779999999999985

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyribonucleoside kinase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=96.34  E-value=0.002  Score=35.52  Aligned_cols=22  Identities=18%  Similarity=0.344  Sum_probs=18.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+-|++-|..|+|||+++..
T Consensus         7 ~kp~~I~ieG~~GsGKTTl~~~   28 (197)
T d2vp4a1           7 TQPFTVLIEGNIGSGKTTYLNH   28 (197)
T ss_dssp             CCCEEEEEECSTTSCHHHHHHT
T ss_pred             CCceEEEEECCCCCCHHHHHHH
Confidence            3456789999999999999974

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Branched chain aminoacid ABC transporter
species: Thermotoga maritima, TM1139 [TaxId: 2336]

Probab=96.34  E-value=0.00097  Score=39.15  Aligned_cols=17  Identities=29%  Similarity=0.558  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        35 ~~liGpnGaGKSTl~~~   51 (240)
T d1ji0a_          35 VTLIGANGAGKTTTLSA   51 (240)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            57899999999999973

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: LAO/AO transport system kinase ArgK
species: Escherichia coli [TaxId: 562]

Probab=96.33  E-value=0.0013  Score=40.11  Aligned_cols=21  Identities=24%  Similarity=0.403  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.|-+.|+.|+|||||+.+
T Consensus        53 ~~~~IgitG~pGaGKSTLi~~   73 (327)
T d2p67a1          53 NTLRLGVTGTPGAGKSTFLEA   73 (327)
T ss_dssp             CSEEEEEEECTTSCHHHHHHH
T ss_pred             CceEEEeeCCCCCCHHHHHHH
Confidence            357899999999999999986

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein rbstp0775
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.32  E-value=0.0014  Score=35.64  Aligned_cols=20  Identities=25%  Similarity=0.154  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+-|.+-|++|+|||+++.+
T Consensus        22 ~~iIgI~G~~GSGKSTla~~   41 (198)
T d1rz3a_          22 RLVLGIDGLSRSGKTTLANQ   41 (198)
T ss_dssp             SEEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            45677999999999999985

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]

Probab=96.30  E-value=0.0011  Score=39.37  Aligned_cols=18  Identities=17%  Similarity=0.458  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 i~~iiG~sGsGKSTLl~~   47 (258)
T d1b0ua_          30 VISIIGSSGSGKSTFLRC   47 (258)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999974

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ABC transporter involved in vitamin B12 uptake, BtuD
species: Escherichia coli [TaxId: 562]

Probab=96.26  E-value=0.00074  Score=39.38  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+..
T Consensus        28 ~~iiG~nGaGKSTLl~~   44 (231)
T d1l7vc_          28 LHLVGPNGAGKSTLLAR   44 (231)
T ss_dssp             EECBCCTTSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67899999999999973

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Escherichia coli [TaxId: 562]

Probab=96.22  E-value=0.00077  Score=37.54  Aligned_cols=18  Identities=28%  Similarity=0.305  Sum_probs=14.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|++.||+|+||+++..+
T Consensus         5 iI~I~GppGSGKgT~ak~   22 (225)
T d1ckea_           5 VITIDGPSGAGKGTLCKA   22 (225)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            345569999999999975

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Chromosomal replication initiation factor DnaA
species: Aquifex aeolicus [TaxId: 63363]

Probab=96.21  E-value=0.0013  Score=37.62  Aligned_cols=17  Identities=35%  Similarity=0.556  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+|+..
T Consensus        39 l~l~G~~G~GKTHLl~A   55 (213)
T d1l8qa2          39 IFIYGSVGTGKTHLLQA   55 (213)
T ss_dssp             EEEECSSSSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67889999999999975

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

Probab=96.21  E-value=0.0014  Score=38.39  Aligned_cols=18  Identities=44%  Similarity=0.595  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||+|+|||+++..
T Consensus        44 giLl~GppGtGKT~la~a   61 (247)
T d1ixza_          44 GVLLVGPPGVGKTHLARA   61 (247)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             eEEEecCCCCChhHHHHH
Confidence            589999999999999975

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ1267
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=96.14  E-value=0.0014  Score=38.63  Aligned_cols=17  Identities=29%  Similarity=0.604  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        33 ~~liG~nGaGKSTLl~~   49 (254)
T d1g6ha_          33 TLIIGPNGSGKSTLINV   49 (254)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            57899999999999973

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=96.13  E-value=0.0013  Score=36.54  Aligned_cols=18  Identities=28%  Similarity=0.231  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+++|++|+|||++..+
T Consensus        10 iI~l~G~pGSGKsT~a~~   27 (194)
T d3adka_          10 IIFVVGGPGSGKGTQCEK   27 (194)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477899999999999985

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.10  E-value=0.0015  Score=36.81  Aligned_cols=18  Identities=33%  Similarity=0.438  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.||.|+|||+++..
T Consensus        37 ~lLl~Gp~G~GKttl~~~   54 (227)
T d1sxjc2          37 HLLFYGPPGTGKTSTIVA   54 (227)
T ss_dssp             CEEEECSSSSSHHHHHHH
T ss_pred             eEEEECCCCCChhHHHHH
Confidence            478999999999999974

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]

Probab=96.09  E-value=0.0016  Score=38.15  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=14.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +-++|++|+|||+|+.-
T Consensus        31 ~glvG~nGaGKSTLl~~   47 (238)
T d1vpla_          31 FGLIGPNGAGKTTTLRI   47 (238)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56899999999999973

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric traffic ATPase, HP0525
species: Helicobacter pylori [TaxId: 210]

Probab=96.09  E-value=0.0018  Score=39.39  Aligned_cols=19  Identities=37%  Similarity=0.504  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++.|++|+|||+++..
T Consensus       167 ~nili~G~tgSGKTT~l~a  185 (323)
T d1g6oa_         167 KNVIVCGGTGSGKTTYIKS  185 (323)
T ss_dssp             CCEEEEESTTSSHHHHHHH
T ss_pred             CCEEEEeeccccchHHHHH
Confidence            4589999999999999975

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.08  E-value=0.0017  Score=35.18  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.+.|++|+|||+++..
T Consensus        25 v~~i~G~~GsGKT~l~l~   42 (242)
T d1n0wa_          25 ITEMFGEFRTGKTQICHT   42 (242)
T ss_dssp             EEEEECCTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            367889999999999986

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=96.04  E-value=0.0018  Score=38.19  Aligned_cols=19  Identities=16%  Similarity=0.226  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+.+.|.+|+|||+|+..
T Consensus        45 ~~v~I~GmgGiGKTtLA~~   63 (277)
T d2a5yb3          45 FFLFLHGRAGSGKSVIASQ   63 (277)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4578999999999999974

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=96.04  E-value=0.0019  Score=38.09  Aligned_cols=19  Identities=37%  Similarity=0.412  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.||+|+|||.++..
T Consensus        46 ~~iLL~GppGtGKT~la~~   64 (256)
T d1lv7a_          46 KGVLMVGPPGTGKTLLAKA   64 (256)
T ss_dssp             CEEEEECCTTSCHHHHHHH
T ss_pred             CeEEeeCCCCCCccHHHHH
Confidence            4589999999999999975

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cell division protein MukB
species: Escherichia coli [TaxId: 562]

Probab=96.03  E-value=0.00025  Score=38.36  Aligned_cols=16  Identities=25%  Similarity=0.497  Sum_probs=14.1

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|++|+|||+++..
T Consensus        28 vi~G~NGsGKStil~A   43 (222)
T d1qhla_          28 TLSGGNGAGKSTTMAA   43 (222)
T ss_dssp             HHHSCCSHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHH
Confidence            4679999999999976

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Metallochaperone MeaB
species: Methylobacterium extorquens [TaxId: 408]

Probab=96.03  E-value=0.0031  Score=38.37  Aligned_cols=21  Identities=29%  Similarity=0.406  Sum_probs=18.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.+-+.|+.|+|||||+-+
T Consensus        50 ~~~~igitG~pGaGKSTli~~   70 (323)
T d2qm8a1          50 RAIRVGITGVPGVGKSTTIDA   70 (323)
T ss_dssp             CSEEEEEECCTTSCHHHHHHH
T ss_pred             CceEEeeeCCCCCCHHHHHHH
Confidence            457899999999999999986

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Thermotoga maritima [TaxId: 2336]

Probab=96.03  E-value=0.0012  Score=38.58  Aligned_cols=16  Identities=38%  Similarity=0.627  Sum_probs=14.0

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|+.|+|||+++.+
T Consensus        28 vlvG~NgsGKS~iL~A   43 (308)
T d1e69a_          28 AIVGPNGSGKSNIIDA   43 (308)
T ss_dssp             EEECCTTTCSTHHHHH
T ss_pred             EEECCCCCcHHHHHHH
Confidence            6779999999999864

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.99  E-value=0.002  Score=37.64  Aligned_cols=19  Identities=26%  Similarity=0.302  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.||+|+|||.++..
T Consensus        39 ~giLL~GppGtGKT~l~~a   57 (258)
T d1e32a2          39 RGILLYGPPGTGKTLIARA   57 (258)
T ss_dssp             CEEEEECCTTSSHHHHHHH
T ss_pred             ceeEEecCCCCCchHHHHH
Confidence            4689999999999999874

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.94  E-value=0.0019  Score=38.03  Aligned_cols=20  Identities=30%  Similarity=0.498  Sum_probs=18.0

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++++|+.+.|||||+..
T Consensus        26 ~P~ivvvG~~SsGKSsliNa   45 (299)
T d2akab1          26 LPQIAVVGGQSAGKSSVLEN   45 (299)
T ss_dssp             CCEEEEEEBTTSCHHHHHHH
T ss_pred             CCeEEEEcCCCCCHHHHHHH
Confidence            45799999999999999996

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Lactobacillus casei [TaxId: 1582]

Probab=95.90  E-value=0.0025  Score=36.01  Aligned_cols=18  Identities=28%  Similarity=0.530  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.|++|+|||+++..
T Consensus        16 gvl~~G~sG~GKStlal~   33 (176)
T d1kkma_          16 GVLITGDSGVGKSETALE   33 (176)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            378899999999999985

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=95.85  E-value=0.0018  Score=36.59  Aligned_cols=18  Identities=33%  Similarity=0.407  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||++..+
T Consensus        38 ~~li~G~pGsGKT~~~lq   55 (254)
T d1pzna2          38 ITEVFGEFGSGKTQLAHT   55 (254)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467889999999999987

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.85  E-value=0.0032  Score=35.18  Aligned_cols=20  Identities=30%  Similarity=0.272  Sum_probs=17.0

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+-|.+-|++|+|||++..+
T Consensus         2 P~iIgI~G~~gSGKSTla~~   21 (213)
T d1uj2a_           2 PFLIGVSGGTASGKSSVCAK   21 (213)
T ss_dssp             CEEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            35678899999999999974

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.70  E-value=0.0024  Score=35.62  Aligned_cols=19  Identities=21%  Similarity=0.295  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhHh
Q psy15257         14 KCVVVGDTAVGKTRLICAR   32 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~   32 (65)
                      -+++.|++|+|||+++...
T Consensus        36 ~~li~G~pGsGKT~l~lq~   54 (251)
T d1szpa2          36 ITELFGEFRTGKSQLCHTL   54 (251)
T ss_dssp             EEEEEESTTSSHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHH
Confidence            4678899999999999863

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=95.70  E-value=0.0022  Score=35.75  Aligned_cols=18  Identities=22%  Similarity=0.274  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||.++.+
T Consensus        36 l~~i~G~~G~GKT~~~l~   53 (258)
T d2i1qa2          36 VTEFAGVFGSGKTQIMHQ   53 (258)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            467889999999999986

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Mycoplasma pneumoniae [TaxId: 2104]

Probab=95.63  E-value=0.0025  Score=36.02  Aligned_cols=18  Identities=17%  Similarity=0.399  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.|++|+|||+++..
T Consensus        17 gvli~G~sG~GKS~lal~   34 (177)
T d1knxa2          17 GVLLTGRSGIGKSECALD   34 (177)
T ss_dssp             EEEEEESSSSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            378899999999999985

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=95.57  E-value=0.0032  Score=37.19  Aligned_cols=19  Identities=32%  Similarity=0.499  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+.+.|||||+..
T Consensus        25 P~ivVvG~~ssGKSSliNa   43 (306)
T d1jwyb_          25 PQIVVVGSQSSGKSSVLEN   43 (306)
T ss_dssp             CEEEEEECSSSSHHHHHHH
T ss_pred             CeEEEEeCCCCCHHHHHHH
Confidence            4799999999999999986

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.55  E-value=0.0033  Score=36.94  Aligned_cols=19  Identities=32%  Similarity=0.307  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++..
T Consensus        42 ~giLL~Gp~GtGKT~l~~a   60 (265)
T d1r7ra3          42 KGVLFYGPPGCGKTLLAKA   60 (265)
T ss_dssp             CEEEEBCCTTSSHHHHHHH
T ss_pred             CeEEEECCCCCcchhHHHH
Confidence            4588999999999999975

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.53  E-value=0.003  Score=37.97  Aligned_cols=16  Identities=25%  Similarity=0.567  Sum_probs=14.0

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|++|+|||+++-+
T Consensus        29 ~i~G~NGsGKS~ileA   44 (427)
T d1w1wa_          29 SIIGPNGSGKSNMMDA   44 (427)
T ss_dssp             EEECSTTSSHHHHHHH
T ss_pred             EEECCCCCCHHHHHHH
Confidence            5669999999999875

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

Probab=95.50  E-value=0.0021  Score=38.45  Aligned_cols=18  Identities=33%  Similarity=0.538  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|+.|+|||.++.+
T Consensus        30 ~vLl~G~pG~GKT~lar~   47 (333)
T d1g8pa_          30 GVLVFGDRGTGKSTAVRA   47 (333)
T ss_dssp             CEEEECCGGGCTTHHHHH
T ss_pred             eEEEECCCCccHHHHHHH
Confidence            589999999999999975

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.46  E-value=0.0041  Score=34.89  Aligned_cols=18  Identities=28%  Similarity=0.326  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||++...
T Consensus        39 ~~~i~G~~GsGKT~lalq   56 (258)
T d1v5wa_          39 ITEAFGEFRTGKTQLSHT   56 (258)
T ss_dssp             EEEEECCTTCTHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            567889999999999986

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Staphylococcus xylosus [TaxId: 1288]

Probab=95.46  E-value=0.0035  Score=35.12  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.|++|+|||+++..
T Consensus        17 gvli~G~sg~GKS~la~~   34 (169)
T d1ko7a2          17 GVLITGDSGIGKSETALE   34 (169)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            478999999999998875

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=95.28  E-value=0.0068  Score=34.41  Aligned_cols=21  Identities=24%  Similarity=0.253  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+-|++.|-+|+|||++...
T Consensus        23 kg~vIwltGlsGsGKTTia~~   43 (208)
T d1m7ga_          23 RGLTIWLTGLSASGKSTLAVE   43 (208)
T ss_dssp             SCEEEEEECSTTSSHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            345689999999999999975

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=95.25  E-value=0.0034  Score=35.46  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||.++.+
T Consensus        28 l~li~G~pGsGKT~l~~q   45 (242)
T d1tf7a2          28 IILATGATGTGKTLLVSR   45 (242)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            467889999999999986

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=95.16  E-value=0.0079  Score=36.42  Aligned_cols=22  Identities=23%  Similarity=0.217  Sum_probs=18.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+-|-+.|++|+|||++...
T Consensus        78 k~P~iIGIaG~sgSGKSTla~~   99 (308)
T d1sq5a_          78 RIPYIISIAGSVAVGKSTTARV   99 (308)
T ss_dssp             CCCEEEEEEECTTSSHHHHHHH
T ss_pred             CCCEEEEEeCCCCCCCcHHHHH
Confidence            4557888999999999999874

>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=95.02  E-value=0.011  Score=34.73  Aligned_cols=20  Identities=45%  Similarity=0.602  Sum_probs=18.1

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+||-++|-+.||||||..+
T Consensus         2 ~~~~GivG~Pn~GKSTlf~~   21 (278)
T d1jala1           2 GFKCGIVGLPNVGKSTLFNA   21 (278)
T ss_dssp             CCEEEEECCTTSSHHHHHHH
T ss_pred             CceEEEECCCCCCHHHHHHH
Confidence            36999999999999999985

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

Probab=95.00  E-value=0.0092  Score=34.98  Aligned_cols=22  Identities=27%  Similarity=0.546  Sum_probs=19.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.++|-++||||||+.+
T Consensus       110 ~~~~~v~vvG~PNvGKSsliN~  131 (273)
T d1puja_         110 PRAIRALIIGIPNVGKSTLINR  131 (273)
T ss_dssp             CCCEEEEEEESTTSSHHHHHHH
T ss_pred             CCceEEEEEecCccchhhhhhh
Confidence            3568999999999999999986

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=94.96  E-value=0.0094  Score=35.89  Aligned_cols=18  Identities=39%  Similarity=0.538  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++||+|||||.++..
T Consensus        55 ~~lf~Gp~G~GKt~lak~   72 (315)
T d1qvra3          55 SFLFLGPTGVGKTELAKT   72 (315)
T ss_dssp             EEEEBSCSSSSHHHHHHH
T ss_pred             EEEEECCCcchHHHHHHH
Confidence            567889999999999875

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: NTPase P4
species: Bacteriophage phi-12 [TaxId: 161736]

Probab=94.91  E-value=0.0077  Score=36.74  Aligned_cols=17  Identities=41%  Similarity=0.605  Sum_probs=14.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.||+|+|||.++..
T Consensus       126 ~l~~G~pG~GKT~la~a  142 (321)
T d1w44a_         126 VIVTGKGNSGKTPLVHA  142 (321)
T ss_dssp             EEEECSSSSCHHHHHHH
T ss_pred             EEEECCCCccHHHHHHH
Confidence            34469999999999975

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=94.86  E-value=0.0058  Score=33.78  Aligned_cols=18  Identities=28%  Similarity=0.398  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||.++..
T Consensus        28 ~~~I~G~~G~GKT~la~~   45 (242)
T d1tf7a1          28 STLVSGTSGTGKTLFSIQ   45 (242)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHH
Confidence            467789999999999875

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=94.85  E-value=0.012  Score=33.20  Aligned_cols=20  Identities=35%  Similarity=0.421  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.++.++|..+.|||+|+-+
T Consensus         3 ~ini~iiGhvd~GKSTL~~~   22 (204)
T d2c78a3           3 HVNVGTIGHVDHGKTTLTAA   22 (204)
T ss_dssp             EEEEEEECSTTSSHHHHHHH
T ss_pred             CeEEEEEeCCCCcHHHHHHH
Confidence            57999999999999999986

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Bacillus stearothermophilus, PcrA [TaxId: 1422]

Probab=94.78  E-value=0.0078  Score=35.18  Aligned_cols=17  Identities=24%  Similarity=0.511  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++|.|..|+|||+.+..
T Consensus        27 ~lV~g~aGSGKTt~l~~   43 (318)
T d1pjra1          27 LLIMAGAGSGKTRVLTH   43 (318)
T ss_dssp             EEEEECTTSCHHHHHHH
T ss_pred             EEEEecCCccHHHHHHH
Confidence            77889999999988764

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=94.66  E-value=0.01  Score=34.21  Aligned_cols=17  Identities=18%  Similarity=0.429  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus        38 ~vi~G~~G~GKT~~~~~   54 (277)
T d1cr2a_          38 IMVTSGSGMGKSTFVRQ   54 (277)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHH
Confidence            67889999999999876

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxycytidine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.63  E-value=0.012  Score=32.97  Aligned_cols=19  Identities=26%  Similarity=0.438  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++-|..|+|||+++..
T Consensus         3 k~I~ieG~dGsGKST~~~~   21 (241)
T d1p5zb_           3 KKISIEGNIAAGKSTFVNI   21 (241)
T ss_dssp             EEEEEECSTTSSHHHHHTT
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3578889999999999974

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=94.56  E-value=0.015  Score=33.51  Aligned_cols=18  Identities=39%  Similarity=0.621  Sum_probs=14.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|-+|||||++...
T Consensus        10 ~i~~sGKGGVGKTTvaa~   27 (296)
T d1ihua1          10 YLFFTGKGGVGKTSISCA   27 (296)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCcChHHHHHHH
Confidence            346789999999998764

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=94.53  E-value=0.013  Score=34.61  Aligned_cols=21  Identities=33%  Similarity=0.425  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|+-++|-+.||||||..+
T Consensus         9 ~~~kiGivG~Pn~GKSTlfna   29 (296)
T d1ni3a1           9 NNLKTGIVGMPNVGKSTFFRA   29 (296)
T ss_dssp             SCCEEEEEECSSSSHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            458999999999999999985

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=94.53  E-value=0.011  Score=33.81  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++-|+.|+|||+++..
T Consensus        36 ~~Ll~Gp~G~GKtt~a~~   53 (239)
T d1njfa_          36 AYLFSGTRGVGKTSIARL   53 (239)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHH
Confidence            367889999999999864

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=94.47  E-value=0.011  Score=33.23  Aligned_cols=18  Identities=22%  Similarity=0.309  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.|+|||+++..
T Consensus        26 ~lLl~Gp~G~GKtt~a~~   43 (207)
T d1a5ta2          26 ALLIQALPGMGDDALIYA   43 (207)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            488999999999999974

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric replicative helicase repA
species: Escherichia coli [TaxId: 562]

Probab=94.44  E-value=0.0093  Score=34.20  Aligned_cols=17  Identities=24%  Similarity=0.268  Sum_probs=14.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .++.|++|+|||+|+..
T Consensus        32 ~~i~G~~G~GKS~l~l~   48 (274)
T d1nlfa_          32 GALVSPGGAGKSMLALQ   48 (274)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHH
Confidence            56889999999999975

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Escherichia coli, RepD [TaxId: 562]

Probab=94.40  E-value=0.0094  Score=34.40  Aligned_cols=17  Identities=41%  Similarity=0.808  Sum_probs=14.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++|+|+.|+|||+.+..
T Consensus        17 ~lI~g~aGTGKTt~l~~   33 (306)
T d1uaaa1          17 CLVLAGAGSGKTRVITN   33 (306)
T ss_dssp             EEECCCTTSCHHHHHHH
T ss_pred             EEEEeeCCccHHHHHHH
Confidence            67889999999988754

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Papillomavirus large T antigen helicase domain
species: Simian virus 40 [TaxId: 10633]

Probab=94.34  E-value=0.012  Score=36.09  Aligned_cols=18  Identities=33%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.||.|+|||+++..
T Consensus       156 ~~~~~g~~~~gk~~~~~~  173 (362)
T d1svma_         156 YWLFKGPIDSGKTTLAAA  173 (362)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578899999999999875

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Nitrogenase iron protein
species: Clostridium pasteurianum [TaxId: 1501]

Probab=94.33  E-value=0.011  Score=34.01  Aligned_cols=19  Identities=16%  Similarity=0.312  Sum_probs=16.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|.+.|-+|||||++...
T Consensus         2 r~Iai~gKGGvGKTT~a~n   20 (269)
T d1cp2a_           2 RQVAIYGKGGIGKSTTTQN   20 (269)
T ss_dssp             EEEEEEECTTSSHHHHHHH
T ss_pred             CEEEEECCCcCCHHHHHHH
Confidence            3677889999999999874

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Bacterial conjugative coupling protein TrwB
species: Escherichia coli [TaxId: 562]

Probab=94.33  E-value=0.011  Score=35.95  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|.+|+|||.++..
T Consensus        52 H~~I~G~tGsGKT~~l~~   69 (433)
T d1e9ra_          52 HLLVNGATGTGKSVLLRE   69 (433)
T ss_dssp             CEEEEECTTSSHHHHHHH
T ss_pred             eEEEEeCCCCcHHHHHHH
Confidence            488999999999998754

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=94.27  E-value=0.014  Score=33.16  Aligned_cols=17  Identities=35%  Similarity=0.468  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |.++|..++|||||+.+
T Consensus         8 IaIiGh~d~GKSTL~~~   24 (227)
T d1g7sa4           8 VSVLGHVDHGKTTLLDH   24 (227)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEEeCCCccHHHHHHH
Confidence            88999999999999975

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=94.19  E-value=0.0043  Score=37.43  Aligned_cols=18  Identities=17%  Similarity=0.287  Sum_probs=13.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|.+.|++|+|||++..+
T Consensus         6 IIgIaG~SGSGKTTva~~   23 (288)
T d1a7ja_           6 IISVTGSSGAGTSTVKHT   23 (288)
T ss_dssp             EEEEESCC---CCTHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            478999999999999975

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor eIF2 gamma subunit, N-terminal (G) domain
species: Archaeon Pyrococcus abyssi [TaxId: 29292]

Probab=94.12  E-value=0.03  Score=30.85  Aligned_cols=21  Identities=38%  Similarity=0.347  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|.-+.|||+|+.+
T Consensus         4 ~~inIaiiGhvd~GKSTL~~~   24 (195)
T d1kk1a3           4 AEVNIGMVGHVDHGKTTLTKA   24 (195)
T ss_dssp             EEEEEEEECSTTSSHHHHHHH
T ss_pred             CcEEEEEEeccCCcHHHHHHH
Confidence            456999999999999999985

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=94.06  E-value=0.018  Score=31.58  Aligned_cols=18  Identities=22%  Similarity=0.289  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++-|.-|+|||+++..
T Consensus         2 lI~ieG~dGsGKST~~~~   19 (208)
T d1gsia_           2 LIAIEGVDGAGKRTLVEK   19 (208)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478889999999999874

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: YjeE-like
domain: Hypothetical protein HI0065
species: Haemophilus influenzae [TaxId: 727]

Probab=94.04  E-value=0.013  Score=32.39  Aligned_cols=18  Identities=33%  Similarity=0.399  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.+-||-|+|||++++.
T Consensus        35 ii~L~G~LGaGKTtfvr~   52 (158)
T d1htwa_          35 MVYLNGDLGAGKTTLTRG   52 (158)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEecCCCccHHHHHHH
Confidence            477889999999999975

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Thermus thermophilus [TaxId: 274]

Probab=94.04  E-value=0.019  Score=31.36  Aligned_cols=19  Identities=16%  Similarity=0.312  Sum_probs=16.0

Q ss_pred             eeEEEEECCCCChHHHHHh
Q psy15257         12 LVKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~   30 (65)
                      .+-|.+.|..|+|||+++.
T Consensus         3 p~IIgitG~~gSGKstva~   21 (191)
T d1uf9a_           3 PIIIGITGNIGSGKSTVAA   21 (191)
T ss_dssp             CEEEEEEECTTSCHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            3567788999999999986

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Transcription termination factor Rho, ATPase domain
species: Escherichia coli [TaxId: 562]

Probab=93.97  E-value=0.014  Score=35.20  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|++|+|||+|+..
T Consensus        44 Qr~~I~g~~g~GKT~l~~~   62 (289)
T d1xpua3          44 QRGLIVAPPKAGKTMLLQN   62 (289)
T ss_dssp             CEEEEEECSSSSHHHHHHH
T ss_pred             CeeeEeCCCCCCHHHHHHH
Confidence            4788999999999999874

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain
species: Pseudomonas syringae pv. tomato [TaxId: 323]

Probab=93.88  E-value=0.042  Score=31.40  Aligned_cols=23  Identities=26%  Similarity=0.524  Sum_probs=20.0

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++++|.-+.|||+|+.+
T Consensus         6 ~~~~~~i~viGHVd~GKSTL~~~   28 (222)
T d1zunb3           6 RKEMLRFLTCGNVDDGKSTLIGR   28 (222)
T ss_dssp             SCEEEEEEEECCTTSSHHHHHHH
T ss_pred             cCCcceEEEEcCCCCCHHHHHHH
Confidence            34568899999999999999986

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=93.76  E-value=0.019  Score=33.00  Aligned_cols=19  Identities=32%  Similarity=0.480  Sum_probs=14.3

Q ss_pred             eEE-EEECCCCChHHHHHhH
Q psy15257         13 VKC-VVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kv-v~lG~~gvGKTsl~~~   31 (65)
                      .+| ++-|-+|||||++...
T Consensus        20 ~~iii~sGKGGVGKTT~a~n   39 (279)
T d1ihua2          20 HGLIMLMGKGGVGKTTMAAA   39 (279)
T ss_dssp             CEEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHH
Confidence            344 5559999999998654

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Extracellular secretion NTPase EpsE
species: Vibrio cholerae [TaxId: 666]

Probab=93.60  E-value=0.019  Score=35.47  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|.|||+++..
T Consensus       160 liLvtGpTGSGKSTTl~~  177 (401)
T d1p9ra_         160 IILVTGPTGSGKSTTLYA  177 (401)
T ss_dssp             EEEEECSTTSCHHHHHHH
T ss_pred             eEEEEcCCCCCccHHHHH
Confidence            488999999999999985

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor eIF2 gamma subunit, N-terminal (G) domain
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=93.55  E-value=0.038  Score=30.69  Aligned_cols=21  Identities=43%  Similarity=0.433  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++.++|.-+.|||+|+-+
T Consensus         7 p~ini~iiGhVd~GKSTL~~~   27 (205)
T d2qn6a3           7 PEVNIGVVGHVDHGKTTLVQA   27 (205)
T ss_dssp             CCEEEEEECSTTSSHHHHHHH
T ss_pred             CCeEEEEEEccCCcHHHHHHH
Confidence            457999999888899999985

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Nitrogenase iron protein
species: Azotobacter vinelandii [TaxId: 354]

Probab=93.48  E-value=0.019  Score=33.34  Aligned_cols=18  Identities=22%  Similarity=0.578  Sum_probs=15.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++-|-+|||||++...
T Consensus         4 ~IaisgKGGVGKTT~a~N   21 (289)
T d2afhe1           4 QCAIYGKGGIGKSTTTQN   21 (289)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            667789999999998764

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Dethiobiotin synthetase
species: Escherichia coli [TaxId: 562]

Probab=93.34  E-value=0.021  Score=31.20  Aligned_cols=19  Identities=42%  Similarity=0.618  Sum_probs=15.4

Q ss_pred             eEEEEECCC-CChHHHHHhH
Q psy15257         13 VKCVVVGDT-AVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~-gvGKTsl~~~   31 (65)
                      .|+++.|-. |||||++...
T Consensus         2 ~~~~i~gt~~GVGKTtvs~~   21 (224)
T d1byia_           2 KRYFVTGTDTEVGKTVASCA   21 (224)
T ss_dssp             EEEEEEESSTTSCHHHHHHH
T ss_pred             ceEEEEECCCCccHHHHHHH
Confidence            478888985 9999988764

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein Ygr205W
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.24  E-value=0.044  Score=32.74  Aligned_cols=21  Identities=14%  Similarity=0.009  Sum_probs=17.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+-|-+-|..|+|||++...
T Consensus        26 ~P~iIGi~G~qGSGKSTl~~~   46 (286)
T d1odfa_          26 CPLFIFFSGPQGSGKSFTSIQ   46 (286)
T ss_dssp             SCEEEEEECCTTSSHHHHHHH
T ss_pred             CCEEEEeECCCCCCHHHHHHH
Confidence            346777899999999998863

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus, EF-G-2 [TaxId: 274]

Probab=92.89  E-value=0.028  Score=33.18  Aligned_cols=19  Identities=37%  Similarity=0.447  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++.++|..+.|||+|+-+
T Consensus         3 RNv~iiGh~~~GKTtL~e~   21 (267)
T d2dy1a2           3 RTVALVGHAGSGKTTLTEA   21 (267)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             eEEEEEcCCCCcHHHHHHH
Confidence            4789999999999999986

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=92.53  E-value=0.041  Score=32.66  Aligned_cols=21  Identities=19%  Similarity=0.140  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|..+.|||+|+-+
T Consensus         5 ~iRni~i~gh~~~GKTtL~e~   25 (276)
T d2bv3a2           5 RLRNIGIAAHIDAGKTTTTER   25 (276)
T ss_dssp             GEEEEEEEECTTSCHHHHHHH
T ss_pred             hceEEEEEeCCCCCHHHHHHH
Confidence            345899999999999999986

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.39  E-value=0.065  Score=31.63  Aligned_cols=20  Identities=30%  Similarity=0.418  Sum_probs=17.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-|.++|+.++|||+|+-+
T Consensus        32 v~vvsi~G~~~sGKS~llN~   51 (277)
T d1f5na2          32 MVVVAIVGLYRTGKSYLMNK   51 (277)
T ss_dssp             EEEEEEEEBTTSSHHHHHHH
T ss_pred             EEEEEEECCCCCCHHHHHHH
Confidence            45677999999999999985

>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Cow (Bos taurus), mitochondrial [TaxId: 9913]

Probab=92.39  E-value=0.059  Score=30.15  Aligned_cols=20  Identities=35%  Similarity=0.421  Sum_probs=18.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.++.++|--+.|||+|+-+
T Consensus         3 ~ini~iiGHvd~GKSTL~~~   22 (196)
T d1d2ea3           3 HVNVGTIGHVDHGKTTLTAA   22 (196)
T ss_dssp             EEEEEEESSTTSSHHHHHHH
T ss_pred             CcEEEEEeCCCCcHHHHHHH
Confidence            57899999999999999985

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=92.28  E-value=0.027  Score=32.06  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++-|.-|+|||+|+.+
T Consensus         5 v~iitGFLGaGKTTll~~   22 (222)
T d1nija1           5 VTLLTGFLGAGKTTLLRH   22 (222)
T ss_dssp             EEEEEESSSSSCHHHHHH
T ss_pred             EEEEeeCCCCCHHHHHHH
Confidence            357789999999999986

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Escherichia coli [TaxId: 562]

Probab=92.23  E-value=0.055  Score=30.13  Aligned_cols=18  Identities=17%  Similarity=0.272  Sum_probs=15.7

Q ss_pred             eEEEEECCCCChHHHHHh
Q psy15257         13 VKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~   30 (65)
                      |-|.+.|..|+|||+.+.
T Consensus         4 ~iIgitG~igSGKStv~~   21 (208)
T d1vhta_           4 YIVALTGGIGSGKSTVAN   21 (208)
T ss_dssp             EEEEEECCTTSCHHHHHH
T ss_pred             EEEEEECCCcCCHHHHHH
Confidence            456789999999999886

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Haemophilus influenzae [TaxId: 727]

Probab=92.12  E-value=0.06  Score=29.86  Aligned_cols=18  Identities=22%  Similarity=0.246  Sum_probs=15.8

Q ss_pred             eEEEEECCCCChHHHHHh
Q psy15257         13 VKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~   30 (65)
                      +-|-+.|..|+|||+++.
T Consensus         3 ~iIgITG~igSGKStv~~   20 (205)
T d1jjva_           3 YIVGLTGGIGSGKTTIAN   20 (205)
T ss_dssp             EEEEEECSTTSCHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            557789999999999986

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.02  E-value=0.039  Score=31.01  Aligned_cols=17  Identities=24%  Similarity=0.208  Sum_probs=14.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++-|.-|+|||+++..
T Consensus         6 I~ieG~dGsGKsT~~~~   22 (209)
T d1nn5a_           6 IVLEGVDRAGKSTQSRK   22 (209)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56669999999998864

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=92.00  E-value=0.041  Score=32.82  Aligned_cols=19  Identities=42%  Similarity=0.457  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|++|+|||+|+..
T Consensus        69 Qr~~If~~~g~GKt~l~~~   87 (276)
T d2jdid3          69 GKIGLFGGAGVGKTVLIME   87 (276)
T ss_dssp             CEEEEEECTTSSHHHHHHH
T ss_pred             CEEEeeCCCCCCHHHHHHH
Confidence            3688999999999999885

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Escherichia coli [TaxId: 562]

Probab=91.93  E-value=0.041  Score=30.42  Aligned_cols=18  Identities=28%  Similarity=0.211  Sum_probs=15.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|++-|.-|+|||+++.+
T Consensus         4 fIviEG~dGsGKsT~~~~   21 (210)
T d4tmka_           4 YIVIEGLEGAGKTTARNV   21 (210)
T ss_dssp             EEEEEECTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            366779999999999874

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

Probab=91.59  E-value=0.073  Score=27.36  Aligned_cols=19  Identities=21%  Similarity=0.148  Sum_probs=15.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -..++.+++|.|||.++..
T Consensus         9 ~~~ll~apTGsGKT~~~~~   27 (136)
T d1a1va1           9 QVAHLHAPTGSGKSTKVPA   27 (136)
T ss_dssp             EEEEEECCTTSCTTTHHHH
T ss_pred             CEEEEEeCCCCCHHHHHHH
Confidence            3457889999999987764

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Equine herpesvirus type 4 [TaxId: 10331]

Probab=91.20  E-value=0.097  Score=31.74  Aligned_cols=21  Identities=19%  Similarity=0.226  Sum_probs=18.6

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++=|.-|+|||+++..
T Consensus         5 ~~~rI~iEG~iGsGKSTl~~~   25 (333)
T d1p6xa_           5 TIVRIYLDGVYGIGKSTTGRV   25 (333)
T ss_dssp             EEEEEEEECSTTSSHHHHHHH
T ss_pred             ceEEEEEECCccCCHHHHHHH
Confidence            457899999999999999974

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=91.16  E-value=0.11  Score=29.95  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=19.3

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|-.+.|||+|+-+
T Consensus         4 k~~iNi~iiGHvD~GKsTl~~~   25 (239)
T d1f60a3           4 KSHINVVVIGHVDSGKSTTTGH   25 (239)
T ss_dssp             CEEEEEEEEECTTSCHHHHHHH
T ss_pred             CCccEEEEEeCCCCCHHHHHHH
Confidence            3457999999999999999976

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Transcriptional activator sigm54 (NtrC1), C-terminal domain
species: Aquifex aeolicus [TaxId: 63363]

Probab=91.08  E-value=0.067  Score=30.88  Aligned_cols=18  Identities=22%  Similarity=0.451  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.|+||+.++..
T Consensus        25 pvlI~Ge~GtGK~~~A~~   42 (247)
T d1ny5a2          25 PVLITGESGVGKEVVARL   42 (247)
T ss_dssp             CEEEECSTTSSHHHHHHH
T ss_pred             CEEEECCCCcCHHHHHHH
Confidence            478889999999988863

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=90.93  E-value=0.076  Score=32.34  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=14.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++.|+.|+|||+++.+
T Consensus       165 ~~vI~G~pGTGKTt~i~~  182 (359)
T d1w36d1         165 ISVISGGPGTGKTTTVAK  182 (359)
T ss_dssp             EEEEECCTTSTHHHHHHH
T ss_pred             eEEEEcCCCCCceehHHH
Confidence            467789999999998753

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Herpes simplex virus type 1, different strains [TaxId: 10298]

Probab=90.79  E-value=0.088  Score=31.96  Aligned_cols=21  Identities=24%  Similarity=0.347  Sum_probs=18.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|.+=|.-|+|||+++..
T Consensus         3 ~~lrI~IEG~iGsGKTTl~~~   23 (329)
T d1e2ka_           3 TLLRVYIDGPHGMGKTTTTQL   23 (329)
T ss_dssp             EEEEEEECSCTTSSHHHHHHH
T ss_pred             CceEEEEECCcCCCHHHHHHH
Confidence            456799999999999999974

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyguanosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=90.77  E-value=0.059  Score=30.11  Aligned_cols=18  Identities=28%  Similarity=0.512  Sum_probs=15.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|++=|.-|+|||+++..
T Consensus         4 ~IviEG~~GsGKST~~~~   21 (241)
T d2ocpa1           4 RLSIEGNIAVGKSTFVKL   21 (241)
T ss_dssp             EEEEEECTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            467779999999999974

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=90.38  E-value=0.098  Score=29.49  Aligned_cols=20  Identities=25%  Similarity=0.486  Sum_probs=18.1

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++.++|.-+.|||+|+-+
T Consensus         3 ~iNi~viGHVd~GKTTL~~~   22 (224)
T d1jnya3           3 HLNLIVIGHVDHGKSTLVGR   22 (224)
T ss_dssp             EEEEEEEESTTSSHHHHHHH
T ss_pred             ccEEEEEecCCCCHHHHHHH
Confidence            57999999999999999875

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Escherichia coli [TaxId: 562]

Probab=90.19  E-value=0.095  Score=30.69  Aligned_cols=17  Identities=29%  Similarity=0.389  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ..+.|++|+|||+|+.+
T Consensus        57 tei~G~~gsGKTtl~l~   73 (263)
T d1u94a1          57 VEIYGPESSGKTTLTLQ   73 (263)
T ss_dssp             EEEECSTTSSHHHHHHH
T ss_pred             EEEecCCCcHHHHHHHH
Confidence            56779999999999986

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=89.39  E-value=0.095  Score=29.35  Aligned_cols=18  Identities=22%  Similarity=0.161  Sum_probs=15.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -|++=|.-|+|||+++..
T Consensus         5 ~I~iEG~DGsGKST~~~~   22 (214)
T d1tmka_           5 LILIEGLDRTGKTTQCNI   22 (214)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            477889999999998864

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

Probab=89.07  E-value=0.12  Score=28.00  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=13.6

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      ++++.+|+|.|||.+..
T Consensus        25 n~lv~~pTGsGKT~i~~   41 (200)
T d1wp9a1          25 NCLIVLPTGLGKTLIAM   41 (200)
T ss_dssp             CEEEECCTTSCHHHHHH
T ss_pred             CeEEEeCCCCcHHHHHH
Confidence            46788999999996543

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Varicella-zoster virus [TaxId: 10335]

Probab=88.96  E-value=0.13  Score=31.16  Aligned_cols=21  Identities=19%  Similarity=0.276  Sum_probs=18.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++=|.-|+|||+++..
T Consensus         4 ~~lrI~IEG~iGsGKSTl~~~   24 (331)
T d1osna_           4 GVLRIYLDGAYGIGKTTAAEE   24 (331)
T ss_dssp             EEEEEEEEESSSSCTTHHHHH
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            457899999999999999974

>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Cow (Bos taurus) [TaxId: 9913]

Probab=88.70  E-value=0.072  Score=31.79  Aligned_cols=19  Identities=26%  Similarity=0.524  Sum_probs=16.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|++|+|||+++..
T Consensus        69 Qr~~If~~~g~GKt~ll~~   87 (285)
T d2jdia3          69 QRELIIGDRQTGKTSIAID   87 (285)
T ss_dssp             CBCEEEESTTSSHHHHHHH
T ss_pred             CEEEeecCCCCChHHHHHH
Confidence            4678899999999999864

>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Eukaryotic peptide chain release factor ERF2, G domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=88.48  E-value=0.14  Score=29.42  Aligned_cols=21  Identities=33%  Similarity=0.422  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|.-+.|||+|+-+
T Consensus        23 ~~iNi~iiGHVD~GKSTL~~~   43 (245)
T d1r5ba3          23 EHVNIVFIGHVDAGKSTLGGN   43 (245)
T ss_dssp             EEEEEEEEECGGGTHHHHHHH
T ss_pred             CceEEEEEeeCCCCHHHHHHH
Confidence            356899999999999999876

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=88.30  E-value=0.065  Score=29.45  Aligned_cols=16  Identities=38%  Similarity=0.358  Sum_probs=13.8

Q ss_pred             EEEEECCCCChHHHHH
Q psy15257         14 KCVVVGDTAVGKTRLI   29 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~   29 (65)
                      .+++..|+|+|||...
T Consensus        42 ~~il~apTGsGKT~~a   57 (202)
T d2p6ra3          42 NLLLAMPTAAGKTLLA   57 (202)
T ss_dssp             CEEEECSSHHHHHHHH
T ss_pred             CEEEEcCCCCchhHHH
Confidence            5789999999999764

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor 2 (eEF-2), N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=88.11  E-value=0.14  Score=31.11  Aligned_cols=22  Identities=18%  Similarity=0.261  Sum_probs=18.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+|.++|..+.|||+|+-+
T Consensus        15 ~~IRNI~iiGhvd~GKTTL~d~   36 (341)
T d1n0ua2          15 TNVRNMSVIAHVDHGKSTLTDS   36 (341)
T ss_dssp             GGEEEEEEECCGGGTHHHHHHH
T ss_pred             ccCcEEEEEeCCCCcHHHHHHH
Confidence            3445799999999999999986

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=87.88  E-value=0.093  Score=26.36  Aligned_cols=17  Identities=29%  Similarity=0.300  Sum_probs=13.5

Q ss_pred             eEEEEECCCCChHHHHH
Q psy15257         13 VKCVVVGDTAVGKTRLI   29 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~   29 (65)
                      ..+++..++|.|||..+
T Consensus         8 ~~~il~~~tGsGKT~~~   24 (140)
T d1yksa1           8 MTTVLDFHPGAGKTRRF   24 (140)
T ss_dssp             CEEEECCCTTSSTTTTH
T ss_pred             CcEEEEcCCCCChhHHH
Confidence            46678899999999544

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]

Probab=87.14  E-value=0.078  Score=31.48  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|++|+|||.|+..
T Consensus        68 Qr~~Ifg~~g~GKt~l~~~   86 (276)
T d1fx0a3          68 QRELIIGDRQTGKTAVATD   86 (276)
T ss_dssp             CBCBEEESSSSSHHHHHHH
T ss_pred             ceEeeccCCCCChHHHHHH
Confidence            4678899999999998863

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Transcription-repair coupling factor, TRCF
species: Escherichia coli [TaxId: 562]

Probab=86.89  E-value=0.24  Score=28.51  Aligned_cols=19  Identities=32%  Similarity=0.513  Sum_probs=16.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.||.|+|||-+..+
T Consensus        77 ~~~LL~GdvGsGKT~V~~~   95 (233)
T d2eyqa3          77 MDRLVCGDVGFGKTEVAMR   95 (233)
T ss_dssp             CEEEEECCCCTTTHHHHHH
T ss_pred             cCeEEEcCCCCCcHHHHHH
Confidence            4668889999999988874

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=86.40  E-value=0.25  Score=28.29  Aligned_cols=17  Identities=18%  Similarity=0.360  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++-|++..|||++++.
T Consensus        44 ~iiTGpN~~GKSt~lk~   60 (234)
T d1wb9a2          44 LIITGPNMGGKSTYMRQ   60 (234)
T ss_dssp             EEEECCTTSSHHHHHHH
T ss_pred             EEEeccCchhhHHHHHH
Confidence            67889999999999975

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecG helicase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=86.15  E-value=0.15  Score=29.97  Aligned_cols=19  Identities=26%  Similarity=0.366  Sum_probs=15.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++-||.|+|||-....
T Consensus       105 m~rLL~GdvGSGKT~Va~~  123 (264)
T d1gm5a3         105 MNRLLQGDVGSGKTVVAQL  123 (264)
T ss_dssp             CCCEEECCSSSSHHHHHHH
T ss_pred             ceeeeeccccccccHHHHH
Confidence            4567889999999987764

>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication protein E1 helicase domain
species: Human papillomavirus type 18 [TaxId: 333761]

Probab=85.85  E-value=0.15  Score=29.15  Aligned_cols=18  Identities=22%  Similarity=0.235  Sum_probs=15.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.||.+.|||.++..
T Consensus        55 ~i~~~GP~~TGKS~f~~s   72 (205)
T d1tuea_          55 CLVFCGPANTGKSYFGMS   72 (205)
T ss_dssp             EEEEESCGGGCHHHHHHH
T ss_pred             EEEEECCCCccHHHHHHH
Confidence            367889999999988864

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=85.60  E-value=0.25  Score=27.03  Aligned_cols=13  Identities=31%  Similarity=0.539  Sum_probs=11.3

Q ss_pred             CCCCChHHHHHhH
Q psy15257         19 GDTAVGKTRLICA   31 (65)
Q Consensus        19 G~~gvGKTsl~~~   31 (65)
                      |-+|||||++...
T Consensus         9 ~KGGvGKTtia~n   21 (232)
T d1hyqa_           9 GKGGTGKTTITAN   21 (232)
T ss_dssp             SSSCSCHHHHHHH
T ss_pred             CCCCChHHHHHHH
Confidence            7889999999874

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=85.46  E-value=0.26  Score=26.94  Aligned_cols=17  Identities=29%  Similarity=0.479  Sum_probs=13.2

Q ss_pred             EEEE-CCCCChHHHHHhH
Q psy15257         15 CVVV-GDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~l-G~~gvGKTsl~~~   31 (65)
                      |.+. +.+|||||++...
T Consensus         5 Iav~~~kGGvGKTtia~n   22 (237)
T d1g3qa_           5 ISIVSGKGGTGKTTVTAN   22 (237)
T ss_dssp             EEEECSSTTSSHHHHHHH
T ss_pred             EEEECCCCCCcHHHHHHH
Confidence            4455 6789999999875

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=85.33  E-value=0.28  Score=28.80  Aligned_cols=17  Identities=24%  Similarity=0.309  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ..+.|++++|||+++..
T Consensus        63 ~e~~G~~~~GKT~l~l~   79 (269)
T d1mo6a1          63 IEIYGPESSGKTTVALH   79 (269)
T ss_dssp             EEEECSSSSSHHHHHHH
T ss_pred             EEEecCCCcHHHHHHHH
Confidence            46779999999999875

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Thermus aquaticus [TaxId: 271]

Probab=84.54  E-value=0.33  Score=27.64  Aligned_cols=17  Identities=18%  Similarity=0.475  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++-||+..|||+++..
T Consensus        38 ~iiTGpN~~GKSt~lk~   54 (224)
T d1ewqa2          38 VLITGPNMAGKSTFLRQ   54 (224)
T ss_dssp             EEEESCSSSSHHHHHHH
T ss_pred             EEEECCCccccchhhhh
Confidence            68889999999999975

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Rep 40 protein helicase domain
species: Adeno-associated virus 2, AAV2 [TaxId: 10804]

Probab=83.90  E-value=0.32  Score=28.36  Aligned_cols=18  Identities=28%  Similarity=0.361  Sum_probs=14.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      =+++.|+++.|||.++..
T Consensus       106 ~~~l~G~~~tGKS~f~~~  123 (267)
T d1u0ja_         106 TIWLFGPATTGKTNIAEA  123 (267)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            356779999999999864

>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU
species: Salmonella typhimurium [TaxId: 90371]

Probab=83.81  E-value=0.26  Score=27.40  Aligned_cols=17  Identities=35%  Similarity=0.442  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|.+..|||..+.+
T Consensus         2 iLVtGGarSGKS~~AE~   18 (180)
T d1c9ka_           2 ILVTGGARSGKSRHAEA   18 (180)
T ss_dssp             EEEEECTTSSHHHHHHH
T ss_pred             EEEECCCCccHHHHHHH
Confidence            57889999999999986

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxynucleoside monophosphate kinase
species: Bacteriophage T4 [TaxId: 10665]

Probab=83.74  E-value=0.46  Score=26.31  Aligned_cols=17  Identities=18%  Similarity=0.085  Sum_probs=14.9

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .|.+.|.-|+|||+.+.
T Consensus         3 iIgiTG~igSGKsTva~   19 (241)
T d1deka_           3 LIFLSGVKRSGKDTTAD   19 (241)
T ss_dssp             EEEEECCTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            46788999999999987

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Helicase-like "domain" of reverse gyrase
domain: Helicase-like "domain" of reverse gyrase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=83.69  E-value=0.16  Score=28.50  Aligned_cols=17  Identities=29%  Similarity=0.272  Sum_probs=13.7

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+++++|+|.|||....
T Consensus        60 ~~~i~apTGsGKT~~~~   76 (237)
T d1gkub1          60 SFAATAPTGVGKTSFGL   76 (237)
T ss_dssp             CEECCCCBTSCSHHHHH
T ss_pred             CEEEEecCCChHHHHHH
Confidence            57888999999996543

>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Escherichia coli [TaxId: 562]

Probab=82.47  E-value=0.32  Score=29.40  Aligned_cols=16  Identities=38%  Similarity=0.453  Sum_probs=14.1

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      ++.|-||.|||+|...
T Consensus        18 lfFGLSGTGKTTLs~d   33 (313)
T d2olra1          18 VFFGLSGTGKTTLSTD   33 (313)
T ss_dssp             EEECSTTSSHHHHHCC
T ss_pred             EEEccCCCCcccceeC
Confidence            6779999999999864

>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ATP sulfurylase C-terminal domain
domain: ATP sulfurylase C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=82.46  E-value=0.47  Score=24.95  Aligned_cols=22  Identities=18%  Similarity=0.175  Sum_probs=19.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+-|-+++-|.+++||++|...
T Consensus         4 kqgf~i~~tg~~~~gk~~ia~a   25 (122)
T d1g8fa3           4 KQGFSIVLGNSLTVSREQLSIA   25 (122)
T ss_dssp             GCCEEEEECTTCCSCHHHHHHH
T ss_pred             ccceEEEEeCCCCCCHHHHHHH
Confidence            4568899999999999999875

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V beta chain (RecB), N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=82.11  E-value=0.53  Score=28.11  Aligned_cols=20  Identities=25%  Similarity=0.223  Sum_probs=15.9

Q ss_pred             eEEEEECCCCChHHHHHhHh
Q psy15257         13 VKCVVVGDTAVGKTRLICAR   32 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~   32 (65)
                      -..+|.+..|+|||+.+..|
T Consensus        17 g~~lv~A~AGsGKT~~l~~r   36 (485)
T d1w36b1          17 GERLIEASAGTGKTFTIAAL   36 (485)
T ss_dssp             SCEEEECCTTSCHHHHHHHH
T ss_pred             CCeEEEEcCchHHHHHHHHH
Confidence            35777899999999888653

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Thermus thermophilus [TaxId: 274]

Probab=81.92  E-value=0.27  Score=29.77  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      -++.|-||.|||+|...
T Consensus        17 alffGLSGTGKTTLs~~   33 (318)
T d1j3ba1          17 AVFFGLSGTGKTTLSTD   33 (318)
T ss_dssp             EEEEECTTSCHHHHTCB
T ss_pred             EEEEccCCCCccccccC
Confidence            47789999999999874

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Deinococcus radiodurans [TaxId: 1299]

Probab=80.73  E-value=0.43  Score=27.87  Aligned_cols=17  Identities=35%  Similarity=0.382  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ..+-|++++|||+++..
T Consensus        60 tei~G~~~sGKT~l~l~   76 (268)
T d1xp8a1          60 TEIYGPESGGKTTLALA   76 (268)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEecCCccchHHHHHH
Confidence            45779999999999986

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: gamma subunit of DNA polymerase III, N-domain
species: Thermotoga maritima [TaxId: 2336]

Probab=80.46  E-value=0.72  Score=25.45  Aligned_cols=20  Identities=5%  Similarity=0.029  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++-|+.|+|||+++..
T Consensus        15 ~~~~l~~G~~g~gk~~~a~~   34 (198)
T d2gnoa2          15 GISILINGEDLSYPREVSLE   34 (198)
T ss_dssp             SEEEEEECSSSSHHHHHHHH
T ss_pred             CceEEEECCCCCCHHHHHHH
Confidence            45789999999999999874