Diaphorina citri psyllid: psy15258


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MDPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLQLNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLVTSNSQSQ
ccHHHHHHHHcccCEEEECccccccccccccccccccccccccccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccEEcccccHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccc
*DPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLQLNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDK****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLQLNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLVTSNSQSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication.confidentQ9VQY9
DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.confidentQ9Y248
DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.confidentQ9D600

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032784 [BP]regulation of DNA-dependent transcription, elongationprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0043138 [MF]3'-5' DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000811 [CC]GINS complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0031261, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E9X, chain B
Confidence level:very confident
Coverage over the Query: 1-176
View the alignment between query and template
View the model in PyMOL
Template: 2E9X, chain B
Confidence level:very confident
Coverage over the Query: 176-250
View the alignment between query and template
View the model in PyMOL