Diaphorina citri psyllid: psy15264


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MLAVMSSDQARDISKDFLTTGRTGRRNALPDILGENARTSVADLPDQLGALSTSDGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKVKR
ccccccccccccccccEEEccccccccccHHHHcccHHHHHHHHHHHHHHHHccccccHHHEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc
***********DISKDFLTTGRTGRRNALPDILGENARTSVADLPDQLGALSTSDGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVMSSDQARDISKDFLTTGRTGRRNALPDILGENARTSVADLPDQLGALSTSDGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKVKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0004996 [MF]thyroid-stimulating hormone receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0016500
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0007188 [BP]adenylate cyclase-modulating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0031326 [BP]regulation of cellular biosynthetic processprobableGO:0019222, GO:0031323, GO:0009889, GO:0050794, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ODU, chain A
Confidence level:confident
Coverage over the Query: 28-95
View the alignment between query and template
View the model in PyMOL