Diaphorina citri psyllid: psy15270

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MSGTSGRHIPAFKNIHIVDISVGTEHVLAVSNTGQVFAWGNNSDAQLGLGNQINYREPQLVLALSNKNIRQVSAGRSHSAAWTAPPLPPHTPGHTPSSSLRLGLPQDIPDHYGHLQNKPLPLIRARLKLLNRFSDLIYQVVRLLPLGNVDQDWVQCTPYSWLVHPSLRPLFAPRVYTLPLVRSVGKTMLVGKNFGPSVTVRRLTTKSKQTVKPIFAQISRQVVKMKGSDLRLPSRAWKVKLLGEGADDAGGVFDDTITEMCGELLSGAVPLLVRTPNGVADTGYNRDRYILNPDLSESLQSLMHFKFLGILFGVAIRTKKPLPLPLSPLVWKLIVQEPVTFTDLEDNDTLYAQSLRAIRDIHLSGVTEANFPEIIPLECFEGASWTGRITPIVTGGQSVPLTFANRLQYYEAAIACGFKHSAVVTSNGYLYTFGNGDYGRLGHGTTMNWKVPERVVALNKVHVESVSCGLNHTVCIADKGKAVYAFGDGEYGKLGLGNTGLKPTPQ
ccccccCEEcccccccEEEEEccccccEEEEccccEEEECccccccccccccccccccEEEccccccEEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccCCcccccccccccccCEEEcEEEEEcEEEEcccccccccEEEEECccccccccHHHHHHHHHHHcccccccccccccEEEEEEccccccccccHHHHHHHHHHHHcccccccEEEccccccccccccCEEEEccccccHHHHHHHHHHHHEEEEEEECccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEECcccccCCcccccccCEEEEEccccccEEEEEEEEccEEEEEECcccEEEECcccccCCcccccccEEccEEcccccccEEEEEEcccccEEEEECccccEEEECccccccccccccccccccc
**GTSGRHIPAFKNIHIVDISVGTEHVLAVSNTGQVFAWGNNSDAQLGLGNQINYREPQLVLALSNKNIRQVSAGRSHSAAWTAPPLPPHTPGHTPSSSLRLGLPQDIPDHYGHLQNKPLPLIRARLKLLNRFSDLIYQVVRLLPLGNVDQDWVQCTPYSWLVHPSLRPLFAPRVYTLPLVRSVGKTMLVGKNFGPSVTVRRLTTKSKQTVKPIFAQISRQVVKMKGSDLRLPSRAWKVKLLGEGADDAGGVFDDTITEMCGELLSGAVPLLVRTPNGVADTGYNRDRYILNPDLSESLQSLMHFKFLGILFGVAIRTKKPLPLPLSPLVWKLIVQEPVTFTDLEDNDTLYAQSLRAIRDIHLSGVTEANFPEIIPLECFEGASWTGRITPIVTGGQSVPLTFANRLQYYEAAIACGFKHSAVVTSNGYLYTFGNGDYGRLGHGTTMNWKVPERVVALNKVHVESVSCGLNHTVCIADKGKAVYAFGDGEYGKL*LGN******P*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGTSGRHIPAFKNIHIVDISVGTEHVLAVSNTGQVFAWGNNSDAQLGLGNQINYREPQLVLALSNKNIRQVSAGRSHSAAWTAPPLPPHTPGHTPSSSLRLGLPQDIPDHYGHLQNKPLPLIRARLKLLNRFSDLIYQVVRLLPLGNVDQDWVQCTPYSWLVHPSLRPLFAPRVYTLPLVRSVGKTMLVGKNFGPSVTVRRLTTKSKQTVKPIFAQISRQVVKMKGSDLRLPSRAWKVKLLGEGADDAGGVFDDTITEMCGELLSGAVPLLVRTPNGVADTGYNRDRYILNPDLSESLQSLMHFKFLGILFGVAIRTKKPLPLPLSPLVWKLIVQEPVTFTDLEDNDTLYAQSLRAIRDIHLSGVTEANFPEIIPLECFEGASWTGRITPIVTGGQSVPLTFANRLQYYEAAIACGFKHSAVVTSNGYLYTFGNGDYGRLGHGTTMNWKVPERVVALNKVHVESVSCGLNHTVCIADKGKAVYAFGDGEYGKLGLGNTGLKPTPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable E3 ubiquitin-protein ligase HERC1 Involved in membrane trafficking via some guanine nucleotide exchange factor (GEF) activity and its ability to bind clathrin. Acts as a GEF for Arf and Rab, by exchanging bound GDP for free GTP. Binds phosphatidylinositol 4,5-bisphosphate, which is required for GEF activity. May also act as a E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.confidentQ15751

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4D9S, chain A
Confidence level:very confident
Coverage over the Query: 3-117,140,167-177,188-193,238-241,265-346,367-368,397-506
View the alignment between query and template
View the model in PyMOL
Template: 3OF7, chain A
Confidence level:very confident
Coverage over the Query: 16-112,171-193,235-246,262-347,368-376,388-392,409-499
View the alignment between query and template
View the model in PyMOL
Template: 1ZVD, chain A
Confidence level:very confident
Coverage over the Query: 210-422,437-489
View the alignment between query and template
View the model in PyMOL