Diaphorina citri psyllid: psy15286


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------
MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVTLNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGASIHSDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGLSKVHSRKVWQCPLIKKWNLYGSQPVAFAPVTVQFRSDQKDSSRESDGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATKMQNSRVIKFGLQELGKMTLFFGCQLKTMDLYSDEKSKMLDQKVLTKSFLALSREPTIPKTYVQDLMKKEASMLYRELIKEGGHFYVCGDCTMAEHVYQTLKYVFQHEGNLTEQNAEKLLLRLRDENRYHEDIFGITLRTAEVHKSSRESARIRMYQSGP
cHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHccccccccEEEccccccccccccccccccccccccEEEEEEECcccccccccEEEEEEEcccccccccccEEEEcccccHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHcccccccEEECcccccccccEEEEEEEEEEEEcccccccccccccHHHHHHccccEEEEEEcccccccccEEEEEccccccccccccccccccccccccEEEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEcccccccccccccccccEEEcccccHHHHHHHHHHcccccccccccccccccccccccccCEEcccccccccccEEccccccccccccccccEEEEccccccccccHHHHHHHHHHccccHHHHHHHcccccccEEEEccccccccccHHHHHHHHHcccccEEEEEECcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEcccccccHHHHHHHHHHHHHHHHHccc
MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVTLNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSET****EVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGASIHSDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGLSKVHSRKVWQCPLIKKWNLYGSQPVAFAPVTVQFRSDQKDSSRESDGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDP**P**LQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATKMQNSRVIKFGLQELGKMTLFFGCQLKTMDLYSDEKSKMLDQKVLTKSFLALSREPTIPKTYVQDLMKKEASMLYRELIKEGGHFYVCGDCTMAEHVYQTLKYVFQHEGNLTEQNAEKLLLRLRDENRYHEDIFGITLRTA*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVTLNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGASIHSDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGLSKVHSRKVWQCPLIKKWNLYGSQPVAFAPVTVQFRSDQKDSSRESDGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATKMQNSRVIKFGLQELGKMTLFFGCQLKTMDLYSDEKSKMLDQKVLTKSFLALSREPTIPKTYVQDLMKKEASMLYRELIKEGGHFYVCGDCTMAEHVYQTLKYVFQHEGNLTEQNAEKLLLRLRDENRYHEDIFGITLRTAEVHKSSRESARIRMYQSGP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QE2, chain A
Confidence level:very confident
Coverage over the Query: 1-311,337-342,402-428,443-447,471-476,494-507,556-682
View the alignment between query and template
View the model in PyMOL
Template: 1F20, chain A
Confidence level:very confident
Coverage over the Query: 61-311,337-350,410-428,443-447,471-476,494-508,556-683
View the alignment between query and template
View the model in PyMOL
Template: 1TLL, chain A
Confidence level:very confident
Coverage over the Query: 1-311,337-350,410-428,443-447,471-476,494-508,556-700
View the alignment between query and template
View the model in PyMOL
Template: 1F20, chain A
Confidence level:very confident
Coverage over the Query: 441-547
View the alignment between query and template
View the model in PyMOL
Template: 3QE2, chain A
Confidence level:very confident
Coverage over the Query: 307-388
View the alignment between query and template
View the model in PyMOL