Psyllid ID: psy15286
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 707 | ||||||
| 8473626 | 1174 | RecName: Full=Nitric oxide synthase, sal | 0.483 | 0.291 | 0.534 | 1e-100 | |
| 328723779 | 1190 | PREDICTED: nitric oxide synthase, saliva | 0.421 | 0.250 | 0.592 | 2e-99 | |
| 91090738 | 1105 | PREDICTED: similar to nitric oxide synth | 0.411 | 0.263 | 0.610 | 1e-98 | |
| 328723781 | 1201 | PREDICTED: nitric oxide synthase, saliva | 0.421 | 0.248 | 0.572 | 5e-97 | |
| 221136346 | 1163 | nitric oxide synthase [Gryllus bimaculat | 0.411 | 0.250 | 0.599 | 3e-94 | |
| 157124093 | 1112 | nitric oxide synthase [Aedes aegypti] gi | 0.414 | 0.263 | 0.57 | 7e-89 | |
| 269847876 | 1145 | nitric oxide synthase [Nasonia vitripenn | 0.483 | 0.298 | 0.490 | 1e-88 | |
| 170072245 | 402 | nitric-oxide synthase [Culex quinquefasc | 0.417 | 0.733 | 0.553 | 3e-88 | |
| 40218411 | 496 | nitric oxide synthase [Anopheles pseudop | 0.415 | 0.592 | 0.558 | 4e-87 | |
| 8473620 | 1247 | RecName: Full=Nitric oxide synthase; Sho | 0.415 | 0.235 | 0.551 | 5e-87 |
| >gi|8473626|sp|Q26240.1|NOS_RHOPR RecName: Full=Nitric oxide synthase, salivary gland; Short=NOS gi|1418270|gb|AAB03810.1| nitric oxide synthase [Rhodnius prolixus] | Back alignment and taxonomy information |
|---|
Score = 371 bits (953), Expect = e-100, Method: Compositional matrix adjust.
Identities = 188/352 (53%), Positives = 248/352 (70%), Gaps = 10/352 (2%)
Query: 1 MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVT 60
+LGELGGERL+KL GDEMCGQ QA WAPEVF+VAC+TFCLD DET +ATQ++ S
Sbjct: 660 LLGELGGERLVKLTTGDEMCGQAQACNKWAPEVFSVACDTFCLDSDETFLEATQMLHSEA 719
Query: 61 LNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKPHD 120
+ ASTVRF+ T D L LS +H++KVW+CPL+ K NL+G + R TL +++ + +
Sbjct: 720 VTASTVRFVESATQD-LCKALSHLHNKKVWKCPLLGKRNLHG-KGSTRATLLLEIERNEN 777
Query: 121 CAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHE 180
+Y+PGDHVG+ A N+ +LV GI++ L IDPD+ ++LQ+L E T ++++W PH+
Sbjct: 778 ISYQPGDHVGVLACNRKELVEGIISHLE-SAIDPDKSVQLQILKENTTPDGIVRNWIPHD 836
Query: 181 RLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRF 240
RLP SLRT+L+R+LDITTPP P LLQFFA+ AT +DQE LT LATDSAAYEDWR+W++
Sbjct: 837 RLPTCSLRTMLTRFLDITTPPSPNLLQFFASCATNSEDQEKLTELATDSAAYEDWRYWKY 896
Query: 241 PHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGAS 300
P+LLEVLE+FPS+ + PALL+AQLTPLQPRFYSISS+P + N+IHLTVAVV Y TQ
Sbjct: 897 PNLLEVLEEFPSVRVLPALLIAQLTPLQPRFYSISSAPSLYANQIHLTVAVVQYCTQDGK 956
Query: 301 --IHSDSAAYEDWRHWRFPHLLEVLEQFPSIHLP-----PALLVAQLTPLQP 345
IH A+ + + P+ HLP P ++V T + P
Sbjct: 957 GPIHYGVASNYLYDVTIGDSIYLFTRSAPNFHLPKSDTAPIIMVGPGTGIAP 1008
|
Source: Rhodnius prolixus Species: Rhodnius prolixus Genus: Rhodnius Family: Reduviidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328723779|ref|XP_003247939.1| PREDICTED: nitric oxide synthase, salivary gland-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91090738|ref|XP_967195.1| PREDICTED: similar to nitric oxide synthase [Tribolium castaneum] gi|270013952|gb|EFA10400.1| hypothetical protein TcasGA2_TC012639 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328723781|ref|XP_001946209.2| PREDICTED: nitric oxide synthase, salivary gland-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|221136346|dbj|BAH14964.1| nitric oxide synthase [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
| >gi|157124093|ref|XP_001660328.1| nitric oxide synthase [Aedes aegypti] gi|108874129|gb|EAT38354.1| AAEL009745-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|269847876|ref|NP_001161704.1| nitric oxide synthase [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|170072245|ref|XP_001870131.1| nitric-oxide synthase [Culex quinquefasciatus] gi|167868496|gb|EDS31879.1| nitric-oxide synthase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|40218411|gb|AAR83124.1| nitric oxide synthase [Anopheles pseudopunctipennis] | Back alignment and taxonomy information |
|---|
| >gi|8473620|sp|O61608.2|NOS_ANOST RecName: Full=Nitric oxide synthase; Short=NOS gi|3790537|gb|AAC68577.1| nitric oxide synthase [Anopheles stephensi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 707 | ||||||
| FB|FBgn0011676 | 1349 | Nos "Nitric oxide synthase" [D | 0.394 | 0.206 | 0.510 | 3.6e-112 | |
| MGI|MGI:97360 | 1429 | Nos1 "nitric oxide synthase 1, | 0.459 | 0.227 | 0.345 | 6.6e-76 | |
| RGD|3184 | 1429 | Nos1 "nitric oxide synthase 1, | 0.459 | 0.227 | 0.342 | 1.8e-75 | |
| UNIPROTKB|P29475 | 1434 | NOS1 "Nitric oxide synthase, b | 0.461 | 0.227 | 0.343 | 3.7e-75 | |
| UNIPROTKB|E2RHA7 | 1437 | NOS1 "Uncharacterized protein" | 0.458 | 0.225 | 0.346 | 4.7e-75 | |
| UNIPROTKB|J9P395 | 1465 | NOS1 "Uncharacterized protein" | 0.458 | 0.221 | 0.346 | 5.1e-75 | |
| UNIPROTKB|F1LQC7 | 1202 | Nos3 "Nitric oxide synthase" [ | 0.387 | 0.227 | 0.397 | 1.7e-72 | |
| UNIPROTKB|F1MY54 | 1205 | NOS3 "Nitric oxide synthase" [ | 0.388 | 0.228 | 0.391 | 1.6e-71 | |
| UNIPROTKB|P29473 | 1205 | NOS3 "Nitric oxide synthase, e | 0.388 | 0.228 | 0.391 | 1.6e-71 | |
| UNIPROTKB|F1PV06 | 1205 | NOS3 "Nitric oxide synthase" [ | 0.393 | 0.230 | 0.395 | 2.6e-71 |
| FB|FBgn0011676 Nos "Nitric oxide synthase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 720 (258.5 bits), Expect = 3.6e-112, Sum P(2) = 3.6e-112
Identities = 144/282 (51%), Positives = 188/282 (66%)
Query: 17 DEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVTLNASTVRFLPMTTADS 76
DEMCGQEQ+FR WAPEVF +ACETFCLD +E+LSDA+ + + +L +TVR +P S
Sbjct: 851 DEMCGQEQSFRKWAPEVFKLACETFCLDPEESLSDASLALQNDSLTVNTVRLVPSANKGS 910
Query: 77 LVTGLSKVHSRKVWQCPL-IKKWNLYGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASN 135
L + LSK H++KV C K NL A+TT+ +++ P YEPGDHVGIF +N
Sbjct: 911 LDSSLSKYHNKKVHCCKAKAKPHNLTRLSEGAKTTMLLEICAP-GLEYEPGDHVGIFPAN 969
Query: 136 KWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYL 195
+ +LV G+L RL +G +PDE ++LQ+L E TS + K W+PH+++P +LR LL+R+
Sbjct: 970 RTELVDGLLNRL-VGVDNPDEVLQLQLLKEKQTSNGIFKCWEPHDKIPPDTLRNLLARFF 1028
Query: 196 DIXXXXXXXXXXXXXXXXXXXDDQEILTLLATDSAAYEDWRHWRFPHLLEVLEQFPSIHL 255
D+ D+E L LL DS+AYEDWRHWR PHLL+VLE+FPS
Sbjct: 1029 DLTTPPSRQLLTLLAGFCEDTADKERLELLVNDSSAYEDWRHWRLPHLLDVLEEFPSCRP 1088
Query: 256 PPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQ 297
P LL+AQLTPLQPRFYSISSSP +EIHLTVA+V YR +
Sbjct: 1089 PAPLLLAQLTPLQPRFYSISSSPRRVSDEIHLTVAIVKYRCE 1130
|
|
| MGI|MGI:97360 Nos1 "nitric oxide synthase 1, neuronal" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3184 Nos1 "nitric oxide synthase 1, neuronal" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29475 NOS1 "Nitric oxide synthase, brain" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHA7 NOS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P395 NOS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQC7 Nos3 "Nitric oxide synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MY54 NOS3 "Nitric oxide synthase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29473 NOS3 "Nitric oxide synthase, endothelial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PV06 NOS3 "Nitric oxide synthase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 707 | |||
| cd06202 | 406 | cd06202, Nitric_oxide_synthase, The ferredoxin-red | 3e-81 | |
| pfam00667 | 217 | pfam00667, FAD_binding_1, FAD binding domain | 4e-51 | |
| cd06202 | 406 | cd06202, Nitric_oxide_synthase, The ferredoxin-red | 8e-51 | |
| cd06204 | 416 | cd06204, CYPOR, NADPH cytochrome p450 reductase (C | 6e-37 | |
| cd06202 | 406 | cd06202, Nitric_oxide_synthase, The ferredoxin-red | 3e-34 | |
| cd06202 | 406 | cd06202, Nitric_oxide_synthase, The ferredoxin-red | 8e-34 | |
| cd06182 | 267 | cd06182, CYPOR_like, NADPH cytochrome p450 reducta | 1e-31 | |
| cd06199 | 360 | cd06199, SiR, Cytochrome p450- like alpha subunits | 1e-31 | |
| COG0369 | 587 | COG0369, CysJ, Sulfite reductase, alpha subunit (f | 2e-29 | |
| cd06207 | 382 | cd06207, CyPoR_like, NADPH cytochrome p450 reducta | 6e-28 | |
| cd06204 | 416 | cd06204, CYPOR, NADPH cytochrome p450 reductase (C | 2e-27 | |
| cd06203 | 398 | cd06203, methionine_synthase_red, Human methionine | 7e-26 | |
| COG0369 | 587 | COG0369, CysJ, Sulfite reductase, alpha subunit (f | 1e-25 | |
| cd06206 | 384 | cd06206, bifunctional_CYPOR, These bifunctional pr | 4e-25 | |
| cd06199 | 360 | cd06199, SiR, Cytochrome p450- like alpha subunits | 1e-24 | |
| PRK06214 | 530 | PRK06214, PRK06214, sulfite reductase; Provisional | 3e-22 | |
| pfam00667 | 217 | pfam00667, FAD_binding_1, FAD binding domain | 5e-22 | |
| cd06203 | 398 | cd06203, methionine_synthase_red, Human methionine | 1e-20 | |
| pfam00667 | 217 | pfam00667, FAD_binding_1, FAD binding domain | 5e-19 | |
| cd06207 | 382 | cd06207, CyPoR_like, NADPH cytochrome p450 reducta | 9e-19 | |
| TIGR01931 | 597 | TIGR01931, cysJ, sulfite reductase [NADPH] flavopr | 2e-18 | |
| cd06199 | 360 | cd06199, SiR, Cytochrome p450- like alpha subunits | 8e-18 | |
| PRK06214 | 530 | PRK06214, PRK06214, sulfite reductase; Provisional | 3e-17 | |
| cd06206 | 384 | cd06206, bifunctional_CYPOR, These bifunctional pr | 5e-16 | |
| TIGR01931 | 597 | TIGR01931, cysJ, sulfite reductase [NADPH] flavopr | 2e-15 | |
| cd06204 | 416 | cd06204, CYPOR, NADPH cytochrome p450 reductase (C | 3e-15 | |
| COG0369 | 587 | COG0369, CysJ, Sulfite reductase, alpha subunit (f | 1e-14 | |
| PRK10953 | 600 | PRK10953, cysJ, sulfite reductase subunit alpha; P | 7e-14 | |
| cd06207 | 382 | cd06207, CyPoR_like, NADPH cytochrome p450 reducta | 8e-14 | |
| cd06206 | 384 | cd06206, bifunctional_CYPOR, These bifunctional pr | 2e-13 | |
| PRK06214 | 530 | PRK06214, PRK06214, sulfite reductase; Provisional | 2e-13 | |
| cd06204 | 416 | cd06204, CYPOR, NADPH cytochrome p450 reductase (C | 3e-13 | |
| PRK10953 | 600 | PRK10953, cysJ, sulfite reductase subunit alpha; P | 2e-11 | |
| TIGR03224 | 411 | TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reduc | 4e-11 | |
| cd06208 | 286 | cd06208, CYPOR_like_FNR, These ferredoxin reductas | 8e-11 | |
| cd06203 | 398 | cd06203, methionine_synthase_red, Human methionine | 4e-10 | |
| cd06203 | 398 | cd06203, methionine_synthase_red, Human methionine | 9e-10 | |
| cd06182 | 267 | cd06182, CYPOR_like, NADPH cytochrome p450 reducta | 5e-09 | |
| cd06182 | 267 | cd06182, CYPOR_like, NADPH cytochrome p450 reducta | 1e-08 | |
| TIGR01931 | 597 | TIGR01931, cysJ, sulfite reductase [NADPH] flavopr | 1e-08 | |
| cd06201 | 289 | cd06201, SiR_like2, Cytochrome p450- like alpha su | 1e-07 | |
| cd06207 | 382 | cd06207, CyPoR_like, NADPH cytochrome p450 reducta | 4e-07 | |
| pfam00175 | 106 | pfam00175, NAD_binding_1, Oxidoreductase NAD-bindi | 1e-06 | |
| PLN03116 | 307 | PLN03116, PLN03116, ferredoxin--NADP+ reductase; P | 1e-06 | |
| COG0369 | 587 | COG0369, CysJ, Sulfite reductase, alpha subunit (f | 2e-06 | |
| PRK10953 | 600 | PRK10953, cysJ, sulfite reductase subunit alpha; P | 3e-06 | |
| cd06200 | 245 | cd06200, SiR_like1, Cytochrome p450- like alpha su | 4e-06 | |
| cd06199 | 360 | cd06199, SiR, Cytochrome p450- like alpha subunits | 6e-06 | |
| cd06206 | 384 | cd06206, bifunctional_CYPOR, These bifunctional pr | 8e-06 | |
| cd00322 | 223 | cd00322, FNR_like, Ferredoxin reductase (FNR), an | 4e-05 |
| >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
Score = 263 bits (675), Expect = 3e-81
Identities = 98/177 (55%), Positives = 130/177 (73%), Gaps = 1/177 (0%)
Query: 122 AYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHER 181
Y+PGDHVGIF +N+ +LV +L RL+ PD+ ++L+VL E T+ +IK+W PHER
Sbjct: 31 HYQPGDHVGIFPANRPELVDALLDRLH-DAPPPDQVIKLEVLEERSTALGIIKTWTPHER 89
Query: 182 LPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRFP 241
LP +LR L+RYLDITTPP P LLQ AT AT D+E L +L S+ YEDW+ ++ P
Sbjct: 90 LPPCTLRQALTRYLDITTPPTPQLLQLLATLATDEKDKERLEVLGKGSSEYEDWKWYKNP 149
Query: 242 HLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQG 298
++LEVLE+FPS+ +P +LL+ QL LQPR+YSISSSP +P EIHLTVAVV+YRT+
Sbjct: 150 NILEVLEEFPSLQVPASLLLTQLPLLQPRYYSISSSPDMYPGEIHLTVAVVSYRTRD 206
|
The reductase portion is similar in structure to NADPH dependent cytochrome-450 reductase (CYPOR), having an inserted connecting sub-domain within the FAD binding portion of FNR. NOS differs from CYPOR in a requirement for the cofactor tetrahydrobiopterin and unlike most CYPOR is dimeric. Nitric oxide synthase produces nitric oxide in the conversion of L-arginine to L-citruline. NOS has been implicated in a variety of processes including cytotoxicity, anti-inflamation, neurotransmission, and vascular smooth muscle relaxation. Length = 406 |
| >gnl|CDD|216051 pfam00667, FAD_binding_1, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|99801 cd06204, CYPOR, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|99779 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99796 cd06199, SiR, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|223446 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99801 cd06204, CYPOR, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99800 cd06203, methionine_synthase_red, Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >gnl|CDD|223446 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|99802 cd06206, bifunctional_CYPOR, These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >gnl|CDD|99796 cd06199, SiR, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|235745 PRK06214, PRK06214, sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216051 pfam00667, FAD_binding_1, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99800 cd06203, methionine_synthase_red, Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >gnl|CDD|216051 pfam00667, FAD_binding_1, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|233643 TIGR01931, cysJ, sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >gnl|CDD|99796 cd06199, SiR, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|235745 PRK06214, PRK06214, sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99802 cd06206, bifunctional_CYPOR, These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >gnl|CDD|233643 TIGR01931, cysJ, sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >gnl|CDD|99801 cd06204, CYPOR, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|223446 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182862 PRK10953, cysJ, sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99802 cd06206, bifunctional_CYPOR, These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >gnl|CDD|235745 PRK06214, PRK06214, sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99801 cd06204, CYPOR, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|182862 PRK10953, cysJ, sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >gnl|CDD|99804 cd06208, CYPOR_like_FNR, These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain | Back alignment and domain information |
|---|
| >gnl|CDD|99800 cd06203, methionine_synthase_red, Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >gnl|CDD|99800 cd06203, methionine_synthase_red, Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >gnl|CDD|99779 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|99779 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|233643 TIGR01931, cysJ, sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >gnl|CDD|99798 cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >gnl|CDD|215769 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215586 PLN03116, PLN03116, ferredoxin--NADP+ reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223446 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182862 PRK10953, cysJ, sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99797 cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|99796 cd06199, SiR, Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >gnl|CDD|99802 cd06206, bifunctional_CYPOR, These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 707 | |||
| KOG1158|consensus | 645 | 100.0 | ||
| KOG1159|consensus | 574 | 100.0 | ||
| cd06202 | 406 | Nitric_oxide_synthase The ferredoxin-reductase (FN | 100.0 | |
| COG0369 | 587 | CysJ Sulfite reductase, alpha subunit (flavoprotei | 100.0 | |
| PRK10953 | 600 | cysJ sulfite reductase subunit alpha; Provisional | 100.0 | |
| cd06204 | 416 | CYPOR NADPH cytochrome p450 reductase (CYPOR) serv | 100.0 | |
| TIGR01931 | 597 | cysJ sulfite reductase [NADPH] flavoprotein, alpha | 100.0 | |
| cd06203 | 398 | methionine_synthase_red Human methionine synthase | 100.0 | |
| cd06207 | 382 | CyPoR_like NADPH cytochrome p450 reductase (CYPOR) | 100.0 | |
| cd06206 | 384 | bifunctional_CYPOR These bifunctional proteins fus | 100.0 | |
| PRK06214 | 530 | sulfite reductase; Provisional | 100.0 | |
| cd06199 | 360 | SiR Cytochrome p450- like alpha subunits of E. col | 100.0 | |
| PF00667 | 219 | FAD_binding_1: FAD binding domain; InterPro: IPR00 | 100.0 | |
| PLN03115 | 367 | ferredoxin--NADP(+) reductase; Provisional | 100.0 | |
| cd06182 | 267 | CYPOR_like NADPH cytochrome p450 reductase (CYPOR) | 99.97 | |
| cd06208 | 286 | CYPOR_like_FNR These ferredoxin reductases are rel | 99.96 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 99.96 | |
| cd06201 | 289 | SiR_like2 Cytochrome p450- like alpha subunits of | 99.96 | |
| cd06200 | 245 | SiR_like1 Cytochrome p450- like alpha subunits of | 99.95 | |
| PLN03116 | 307 | ferredoxin--NADP+ reductase; Provisional | 99.94 | |
| PRK10926 | 248 | ferredoxin-NADP reductase; Provisional | 99.71 | |
| PRK08051 | 232 | fre FMN reductase; Validated | 99.69 | |
| PRK13289 | 399 | bifunctional nitric oxide dioxygenase/dihydropteri | 99.69 | |
| cd06188 | 283 | NADH_quinone_reductase Na+-translocating NADH:quin | 99.69 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 99.68 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 99.68 | |
| cd00322 | 223 | FNR_like Ferredoxin reductase (FNR), an FAD and NA | 99.67 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 99.67 | |
| cd06209 | 228 | BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD | 99.66 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 99.66 | |
| cd06190 | 232 | T4MO_e_transfer_like Toluene-4-monoxygenase electr | 99.65 | |
| cd06189 | 224 | flavin_oxioreductase NAD(P)H dependent flavin oxid | 99.65 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 99.65 | |
| cd06211 | 238 | phenol_2-monooxygenase_like Phenol 2-monooxygenase | 99.64 | |
| cd06195 | 241 | FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c | 99.64 | |
| cd06212 | 232 | monooxygenase_like The oxygenase reductase FAD/NAD | 99.63 | |
| cd06210 | 236 | MMO_FAD_NAD_binding Methane monooxygenase (MMO) re | 99.63 | |
| cd06184 | 247 | flavohem_like_fad_nad_binding FAD_NAD(P)H binding | 99.63 | |
| cd06187 | 224 | O2ase_reductase_like The oxygenase reductase FAD/N | 99.62 | |
| cd06191 | 231 | FNR_iron_sulfur_binding Iron-sulfur binding Ferred | 99.62 | |
| cd06194 | 222 | FNR_N-term_Iron_sulfur_binding Iron-sulfur binding | 99.61 | |
| cd06213 | 227 | oxygenase_e_transfer_subunit The oxygenase reducta | 99.6 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 99.59 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 99.59 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 99.56 | |
| cd06196 | 218 | FNR_like_1 Ferredoxin reductase-like proteins cata | 99.55 | |
| cd06214 | 241 | PA_degradation_oxidoreductase_like NAD(P) binding | 99.54 | |
| cd06215 | 231 | FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr | 99.54 | |
| cd06221 | 253 | sulfite_reductase_like Anaerobic sulfite reductase | 99.54 | |
| cd06216 | 243 | FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr | 99.53 | |
| cd06217 | 235 | FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr | 99.51 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 99.5 | |
| PRK08221 | 263 | anaerobic sulfite reductase subunit B; Provisional | 99.48 | |
| COG1018 | 266 | Hmp Flavodoxin reductases (ferredoxin-NADPH reduct | 99.47 | |
| cd06198 | 216 | FNR_like_3 NAD(P) binding domain of ferredoxin red | 99.46 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 99.46 | |
| PTZ00319 | 300 | NADH-cytochrome B5 reductase; Provisional | 99.46 | |
| cd06183 | 234 | cyt_b5_reduct_like Cytochrome b5 reductase catalyz | 99.45 | |
| PTZ00274 | 325 | cytochrome b5 reductase; Provisional | 99.44 | |
| cd06185 | 211 | PDR_like Phthalate dioxygenase reductase (PDR) is | 99.41 | |
| TIGR02911 | 261 | sulfite_red_B sulfite reductase, subunit B. Member | 99.41 | |
| PF00175 | 109 | NAD_binding_1: Oxidoreductase NAD-binding domain ; | 99.34 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 99.33 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 99.31 | |
| PLN02252 | 888 | nitrate reductase [NADPH] | 99.29 | |
| cd06197 | 220 | FNR_like_2 FAD/NAD(P) binding domain of ferredoxin | 99.27 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 99.27 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 99.22 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 99.2 | |
| COG0543 | 252 | UbiB 2-polyprenylphenol hydroxylase and related fl | 99.18 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 99.17 | |
| KOG0534|consensus | 286 | 99.06 | ||
| COG4097 | 438 | Predicted ferric reductase [Inorganic ion transpor | 99.02 | |
| PF00667 | 219 | FAD_binding_1: FAD binding domain; InterPro: IPR00 | 99.01 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 98.98 | |
| KOG1158|consensus | 645 | 98.95 | ||
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 98.91 | |
| KOG1159|consensus | 574 | 98.9 | ||
| COG0369 | 587 | CysJ Sulfite reductase, alpha subunit (flavoprotei | 98.89 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 98.87 | |
| cd06186 | 210 | NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz | 98.78 | |
| cd06193 | 235 | siderophore_interacting Siderophore interacting pr | 98.77 | |
| cd06204 | 416 | CYPOR NADPH cytochrome p450 reductase (CYPOR) serv | 98.61 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 98.59 | |
| cd06202 | 406 | Nitric_oxide_synthase The ferredoxin-reductase (FN | 98.56 | |
| cd06203 | 398 | methionine_synthase_red Human methionine synthase | 98.4 | |
| cd06199 | 360 | SiR Cytochrome p450- like alpha subunits of E. col | 98.32 | |
| cd06207 | 382 | CyPoR_like NADPH cytochrome p450 reductase (CYPOR) | 98.31 | |
| PRK06214 | 530 | sulfite reductase; Provisional | 98.28 | |
| cd06206 | 384 | bifunctional_CYPOR These bifunctional proteins fus | 98.24 | |
| TIGR01931 | 597 | cysJ sulfite reductase [NADPH] flavoprotein, alpha | 98.2 | |
| PRK10953 | 600 | cysJ sulfite reductase subunit alpha; Provisional | 98.2 | |
| PLN02292 | 702 | ferric-chelate reductase | 97.79 | |
| PLN02844 | 722 | oxidoreductase/ferric-chelate reductase | 97.77 | |
| PLN02631 | 699 | ferric-chelate reductase | 97.49 | |
| PF08030 | 156 | NAD_binding_6: Ferric reductase NAD binding domain | 96.24 | |
| KOG3378|consensus | 385 | 96.14 | ||
| PF00970 | 99 | FAD_binding_6: Oxidoreductase FAD-binding domain; | 85.83 |
| >KOG1158|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-83 Score=728.66 Aligned_cols=482 Identities=36% Similarity=0.577 Sum_probs=399.6
Q ss_pred ChhccCceecccceeccCCCCcHHHHHHHHHHHHHHHHHHcCCCCCCcccccccccccccccCceeeeccCCCccccccc
Q psy15286 1 MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISSVTLNASTVRFLPMTTADSLVTG 80 (707)
Q Consensus 1 ~l~~lGa~r~~~~g~gD~~~g~e~~f~~W~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (707)
+|++|||+|++..|+|||+.++|++|..|++.+|+++++.|++++.....+.........+....+++............
T Consensus 155 ~l~~lg~~rl~~~glgdd~~~~e~~f~~w~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 234 (645)
T KOG1158|consen 155 LLEELGANRLFQLGLGDDDAGLEEDFRTWKKPLLPELCETFSLEEDEATKEDETIRQYRTWTPNDPPFVPQAFPPELLNL 234 (645)
T ss_pred HHHHhhhhhhhccccccccccchhHHHHHHHHHhHhhhheeeeccccccCCcccccccccCcCccccccccccCcccccc
Confidence 47899999999999999999999999999999999999999987543211111111111222222222222111111111
Q ss_pred --ccccCCCCcEEEEEeEEeeccCCCCCCCcEEEEEeeC-CCCCCCCCCCeeEEcccCCHHHHHHHHHHhcCCCCCCCCc
Q psy15286 81 --LSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRK-PHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEP 157 (707)
Q Consensus 81 --~~~~~~~~~~~a~V~~n~~Lt~~~~~~r~v~hiel~l-~~~l~Y~pGD~l~I~P~N~~~~V~~lL~~L~L~~~d~d~~ 157 (707)
..+.....++.+.++.+..|.. +.+.+.++|++++. ++++.|+||||++|+|.|+.+.|++++++|++. .+.+..
T Consensus 235 ~~~~~~~~~~~~~~~~~~~~~l~~-~~~~r~~~~~e~~~~~~~~~Y~~GD~~gv~p~N~~~~V~~ll~~l~~~-~~~~~~ 312 (645)
T KOG1158|consen 235 LSSTPFDKVFPFPALVVVNLALST-PSSDRSCIHLELDIYGPGLRYEPGDHFGVLPPNSDELVDELLERLGLN-PDTDFS 312 (645)
T ss_pred ccCCcchhcccchhhhhHHhhccC-CCCceEEEEEEeecCCcccccccCCeeeecCCCCHHHHHHHHHHhcCC-CccceE
Confidence 1233456677788888888887 78899999999997 669999999999999999999999999999952 234444
Q ss_pred eEecccccccccccccccCCCCCCCC-cccHHHHHHHhhccCCCCCHHHHHHHHhhcCCHHHHHHHHHhhhc--hHHHHH
Q psy15286 158 MELQVLSETHTSTEVIKSWKPHERLP-RASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATD--SAAYED 234 (707)
Q Consensus 158 i~l~~~~~~~~~~~~~~~~~~~~~~P-p~tl~~ll~~~lDl~~~p~~~~l~~La~~a~d~~ek~~L~~L~s~--~~~y~~ 234 (707)
+.+....++ + ...|..+.++| ++|++++|++|+||+++|++++++.||+||+|+.||++|+.|++. ...|.+
T Consensus 313 ~~~~~~~~~---~--~~~~~~~~p~~~~~t~~~~l~~~ldi~~~P~k~ll~~La~~a~d~~Eke~L~~L~s~~g~~~y~~ 387 (645)
T KOG1158|consen 313 LQLELETDT---N--PTPAKKPHPFPLPTTLRTALTHYLDITGPPKKQLLRLLAEYATDPAEKERLEILSSKQGAEEYPR 387 (645)
T ss_pred EEEeecCCC---C--CCccccCCCCCCCCcHHHHHHHhccccCCCcHHHHHHHHHhcCCchHHHHHHHHhCccchhhHhH
Confidence 444432221 1 12344455666 999999999999999999999999999999999999999999985 789999
Q ss_pred HhhcCCCCHHHHHhhCCCCCCChHHHHHHhCCCCCCcccccCCCCCCCCeEEEEEEEEEeeccCCCCCcccccccccccc
Q psy15286 235 WRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGASIHSDSAAYEDWRHW 314 (707)
Q Consensus 235 ~~~~~~~slldvL~~f~s~~~pl~~Ll~~lp~l~PR~YSIsSSp~~~p~~i~ltvavv~y~t~~~~~~~r~GlcS~~~~~ 314 (707)
|....+++++|||++||+|++|++.|++++|+++||+|||||||+.+|+++|+++++|+|.++.| +..|+|+||+|
T Consensus 388 ~~~~~~~tl~dVl~~fps~kpP~~~ll~~lp~L~pR~YSIssS~~~~~~~vhl~~~vv~~~~~dg-~~~r~GVcS~~--- 463 (645)
T KOG1158|consen 388 WVRQSCLTLLDVLEAFPSCKPPLPHLLELLPRLQPRYYSISSSPKVHPNEVHLTVTVVEYGTPDG-GPKRYGVCSNW--- 463 (645)
T ss_pred HHhcccccHHHHHhhCCCCCCCHHHHHHhCccccccccccccCcccCCCEEEEEEEEeeeccCCC-CCccceehhhh---
Confidence 99999999999999999999999999999999999999999999999999999999999999998 89999999999
Q ss_pred ccccHHHHhhhCCCCCCChHHHHhccCCCCceeEEecCCCCCCCCcceeEEEEEeecccccCccCccccccccccccccc
Q psy15286 315 RFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGLSKVHSRKVWQCPLIKKWNL 394 (707)
Q Consensus 315 ~~~~~~d~l~~fps~~~~~~~lL~~L~~g~~~~~sIsSs~~~~p~~i~l~v~~V~~~~~~~~~~~~~~~~~~~~~~~~~~ 394 (707)
|..+.+++.+..
T Consensus 464 ----------------------L~~l~~~~~~~~---------------------------------------------- 475 (645)
T KOG1158|consen 464 ----------------------LSNLKPGEKVPN---------------------------------------------- 475 (645)
T ss_pred ----------------------HHhcCCccccCc----------------------------------------------
Confidence 888887765431
Q ss_pred cCCCCCCCCcEEEeeccCCCCCCCCCCCCCCceeeecccccCCCCCcccCCCCcccccccCchhhhhhhhhhccCCCCCC
Q psy15286 395 YGSQPVAFAPVTVQFRSDQKDSSRESDGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDP 474 (707)
Q Consensus 395 ~~~~~~~~~~~~~~~r~~~~~f~lp~~~~~Piim~~~~~~~~~~~~~~i~~Gt~~~~~~~~~~~~~~~~~~~~~~~GiAP 474 (707)
.++++++ .|+||.|+++|||| ||||| ||||
T Consensus 476 -----------~~~~~~s--~frlp~dp~~PiIM--------------IGpGT-----------------------GiAP 505 (645)
T KOG1158|consen 476 -----------PVPVGKS--MFRLPSDPSTPIIM--------------IGPGT-----------------------GIAP 505 (645)
T ss_pred -----------ceeeccc--ceecCCCCCCcEEE--------------EcCCC-----------------------cchh
Confidence 1122222 38999999999999 99999 9999
Q ss_pred CchhhhhhhccccCCcccccccccccCCChhhHhhhhhhccccCCCCChhhhhhhhcccCCcchHHHHHHHHHhhhhhhh
Q psy15286 475 DEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATKMQNSRV 554 (707)
Q Consensus 475 fr~~~~~~~~~~~~~~~~~~f~q~~~R~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 554 (707)
|| |||| +|. +++
T Consensus 506 FR-----------------gFlq--~r~---~~~---------------------------------------------- 517 (645)
T KOG1158|consen 506 FR-----------------GFLQ--ERL---FLK---------------------------------------------- 517 (645)
T ss_pred hH-----------------HHHH--HHH---Hhh----------------------------------------------
Confidence 99 9999 888 642
Q ss_pred hhccc-ccCCceEEEEecCCCCCc-ccHHHHHHHHhcCCCceEEEEEecCCCCCccchhhHHHhhHHHHHHHhhcCCcEE
Q psy15286 555 IKFGL-QELGKMTLFFGCQLKTMD-LYSDEKSKMLDQKVLTKSFLALSREPTIPKTYVQDLMKKEASMLYRELIKEGGHF 632 (707)
Q Consensus 555 ~~~~~-~~~g~i~LffG~R~~~~D-ly~dELe~~~~~g~l~~l~~AfSRe~~~~k~YVQd~L~~~~~~l~~~L~~~ga~i 632 (707)
+.+. ...+ +|||||||+++.| ||++||+.+.+.|.++++.+||||++.+++.||||+|++++++||++|.+++|+|
T Consensus 518 -~~~~~~~~~-~~Lf~GcR~~~~d~LY~eE~~~~~~~~~l~~l~~A~SReq~~~k~YVQd~l~e~~d~v~~~L~~~~g~i 595 (645)
T KOG1158|consen 518 -QQGPKFGGG-MWLFFGCRNSDEDYLYREEWEEYKKAGILTRLDVAFSREQTPKKIYVQDRLREYADEVWELLKKEGGHI 595 (645)
T ss_pred -hcCccCCcc-eEEEEeCCCchHHHHHHHHHHHHHhcCcchhheeeeeccCCCCceehhhHHHHHHHHHHHHHhcCCcEE
Confidence 1111 2334 9999999999999 9999999998889999999999999844799999999999999999998789999
Q ss_pred EEeCChh-hHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhCCcEEEEEe
Q psy15286 633 YVCGDCT-MAEHVYQTLKYVFQHEGNLTEQNAEKLLLRLRDENRYHEDIF 681 (707)
Q Consensus 633 YVCGp~~-M~~~V~~~L~~il~~~~~~~~~~a~~~l~~L~~~gRy~~Dvw 681 (707)
||||+++ |+++|.++|.+|+++.+++++++|.++++.|++++||++|||
T Consensus 596 YvCGd~~~Ma~dV~~~L~~i~~~~g~~~~~ea~~~lk~lk~~~Ry~~DVw 645 (645)
T KOG1158|consen 596 YVCGDAKGMAKDVQDALVRILAKDGGLSEEEAEKYLKQLKKSKRYIEDVW 645 (645)
T ss_pred EEecCCccchHHHHHHHHHHHHhhCCccHHHHHHHHHHhhhccccccccC
Confidence 9999996 999999999999999999999999999999999999999999
|
|
| >KOG1159|consensus | Back alignment and domain information |
|---|
| >cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10953 cysJ sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >PRK06214 sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >cd06199 SiR Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >PF00667 FAD_binding_1: FAD binding domain; InterPro: IPR003097 This domain is found in sulphite reductase, NADPH cytochrome P450 reductase, nitric oxide synthase and methionine synthase reductase | Back alignment and domain information |
|---|
| >PLN03115 ferredoxin--NADP(+) reductase; Provisional | Back alignment and domain information |
|---|
| >cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >PLN03116 ferredoxin--NADP+ reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10926 ferredoxin-NADP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08051 fre FMN reductase; Validated | Back alignment and domain information |
|---|
| >PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
| >cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system | Back alignment and domain information |
|---|
| >cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol | Back alignment and domain information |
|---|
| >cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin | Back alignment and domain information |
|---|
| >cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol | Back alignment and domain information |
|---|
| >cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin | Back alignment and domain information |
|---|
| >cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant | Back alignment and domain information |
|---|
| >cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase | Back alignment and domain information |
|---|
| >cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08221 anaerobic sulfite reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00319 NADH-cytochrome B5 reductase; Provisional | Back alignment and domain information |
|---|
| >cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor | Back alignment and domain information |
|---|
| >PTZ00274 cytochrome b5 reductase; Provisional | Back alignment and domain information |
|---|
| >cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster | Back alignment and domain information |
|---|
| >TIGR02911 sulfite_red_B sulfite reductase, subunit B | Back alignment and domain information |
|---|
| >PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PLN02252 nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >KOG0534|consensus | Back alignment and domain information |
|---|
| >COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00667 FAD_binding_1: FAD binding domain; InterPro: IPR003097 This domain is found in sulphite reductase, NADPH cytochrome P450 reductase, nitric oxide synthase and methionine synthase reductase | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1158|consensus | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1159|consensus | Back alignment and domain information |
|---|
| >COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide | Back alignment and domain information |
|---|
| >cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family | Back alignment and domain information |
|---|
| >cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >cd06199 SiR Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >PRK06214 sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >PRK10953 cysJ sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PLN02292 ferric-chelate reductase | Back alignment and domain information |
|---|
| >PLN02844 oxidoreductase/ferric-chelate reductase | Back alignment and domain information |
|---|
| >PLN02631 ferric-chelate reductase | Back alignment and domain information |
|---|
| >PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins | Back alignment and domain information |
|---|
| >KOG3378|consensus | Back alignment and domain information |
|---|
| >PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 707 | ||||
| 1tll_A | 688 | Crystal Structure Of Rat Neuronal Nitric-Oxide Synt | 5e-45 | ||
| 1tll_A | 688 | Crystal Structure Of Rat Neuronal Nitric-Oxide Synt | 1e-28 | ||
| 1f20_A | 435 | Crystal Structure Of Rat Neuronal Nitric-Oxide Synt | 1e-31 | ||
| 1f20_A | 435 | Crystal Structure Of Rat Neuronal Nitric-Oxide Synt | 8e-26 | ||
| 3qfc_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 (V | 9e-15 | ||
| 3qfc_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 (V | 5e-10 | ||
| 3fjo_A | 637 | Structure Of Chimeric Yh Cpr Length = 637 | 1e-14 | ||
| 3fjo_A | 637 | Structure Of Chimeric Yh Cpr Length = 637 | 5e-10 | ||
| 3qfs_A | 458 | Crystal Structure Of Nadph-Cytochrome P450 Reductas | 2e-14 | ||
| 3qfs_A | 458 | Crystal Structure Of Nadph-Cytochrome P450 Reductas | 3e-10 | ||
| 3qe2_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 Re | 2e-14 | ||
| 3qe2_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 Re | 5e-10 | ||
| 3qfr_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 Re | 6e-14 | ||
| 3qfr_A | 618 | Crystal Structure Of Human Nadph-Cytochrome P450 Re | 5e-10 | ||
| 3ojx_A | 622 | Disulfide Crosslinked Cytochrome P450 Reductase Ina | 8e-14 | ||
| 3ojx_A | 622 | Disulfide Crosslinked Cytochrome P450 Reductase Ina | 5e-09 | ||
| 3qft_A | 458 | Crystal Structure Of Nadph-Cytochrome P450 Reductas | 9e-14 | ||
| 3qft_A | 458 | Crystal Structure Of Nadph-Cytochrome P450 Reductas | 3e-10 | ||
| 1ddg_A | 374 | Crystal Structure Of Sir-Fp60 Length = 374 | 1e-13 | ||
| 2qtl_A | 539 | Crystal Structure Of The Fad-Containing Fnr-Like Mo | 1e-13 | ||
| 2qtz_A | 539 | Crystal Structure Of The Nadp+-Bound Fad-Containing | 1e-13 | ||
| 4dqk_A | 391 | Crystal Structure Of The Fad Binding Domain Of Cyto | 3e-13 | ||
| 4dql_A | 393 | Crystal Structure Of The Fad Binding Domain Of Cyto | 3e-13 | ||
| 1j9z_A | 622 | Cypor-W677g Length = 622 | 5e-13 | ||
| 1j9z_A | 622 | Cypor-W677g Length = 622 | 5e-10 | ||
| 1amo_A | 615 | Three-Dimensional Structure Of Nadph-Cytochrome P45 | 5e-13 | ||
| 1amo_A | 615 | Three-Dimensional Structure Of Nadph-Cytochrome P45 | 5e-10 | ||
| 1ja0_A | 620 | Cypor-W677x Length = 620 | 5e-13 | ||
| 1ja0_A | 620 | Cypor-W677x Length = 620 | 6e-10 | ||
| 3es9_A | 618 | Nadph-Cytochrome P450 Reductase In An Open Conforma | 5e-13 | ||
| 3es9_A | 618 | Nadph-Cytochrome P450 Reductase In An Open Conforma | 5e-10 | ||
| 1ja1_A | 622 | Cypor-Triple Mutant Length = 622 | 1e-12 | ||
| 1ja1_A | 622 | Cypor-Triple Mutant Length = 622 | 2e-08 | ||
| 2bpo_A | 682 | Crystal Structure Of The Yeast Cpr Triple Mutant: D | 6e-10 | ||
| 2bf4_A | 682 | A Second Fmn-Binding Site In Yeast Nadph-Cytochrome | 7e-10 | ||
| 3hr4_A | 219 | Human Inos Reductase And Calmodulin Complex Length | 7e-04 |
| >pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase Reductase Module At 2.3 A Resolution. Length = 688 | Back alignment and structure |
|
| >pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase Reductase Module At 2.3 A Resolution. Length = 688 | Back alignment and structure |
| >pdb|1F20|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase FadNADP+ Domain At 1.9a Resolution Length = 435 | Back alignment and structure |
| >pdb|1F20|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase FadNADP+ Domain At 1.9a Resolution Length = 435 | Back alignment and structure |
| >pdb|3QFC|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 (V492e Mutant) Length = 618 | Back alignment and structure |
| >pdb|3QFC|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 (V492e Mutant) Length = 618 | Back alignment and structure |
| >pdb|3FJO|A Chain A, Structure Of Chimeric Yh Cpr Length = 637 | Back alignment and structure |
| >pdb|3FJO|A Chain A, Structure Of Chimeric Yh Cpr Length = 637 | Back alignment and structure |
| >pdb|3QFS|A Chain A, Crystal Structure Of Nadph-Cytochrome P450 Reductase (FadNADPH Domain) Length = 458 | Back alignment and structure |
| >pdb|3QFS|A Chain A, Crystal Structure Of Nadph-Cytochrome P450 Reductase (FadNADPH Domain) Length = 458 | Back alignment and structure |
| >pdb|3QE2|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 Reductase Length = 618 | Back alignment and structure |
| >pdb|3QE2|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 Reductase Length = 618 | Back alignment and structure |
| >pdb|3QFR|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 Reductase (R457h Mutant) Length = 618 | Back alignment and structure |
| >pdb|3QFR|A Chain A, Crystal Structure Of Human Nadph-Cytochrome P450 Reductase (R457h Mutant) Length = 618 | Back alignment and structure |
| >pdb|3OJX|A Chain A, Disulfide Crosslinked Cytochrome P450 Reductase Inactive Length = 622 | Back alignment and structure |
| >pdb|3OJX|A Chain A, Disulfide Crosslinked Cytochrome P450 Reductase Inactive Length = 622 | Back alignment and structure |
| >pdb|3QFT|A Chain A, Crystal Structure Of Nadph-Cytochrome P450 Reductase (FadNADPH DOMAIN And R457h Mutant) Length = 458 | Back alignment and structure |
| >pdb|3QFT|A Chain A, Crystal Structure Of Nadph-Cytochrome P450 Reductase (FadNADPH DOMAIN And R457h Mutant) Length = 458 | Back alignment and structure |
| >pdb|1DDG|A Chain A, Crystal Structure Of Sir-Fp60 Length = 374 | Back alignment and structure |
| >pdb|2QTL|A Chain A, Crystal Structure Of The Fad-Containing Fnr-Like Module Of Human Methionine Synthase Reductase Length = 539 | Back alignment and structure |
| >pdb|2QTZ|A Chain A, Crystal Structure Of The Nadp+-Bound Fad-Containing Fnr-Like Module Of Human Methionine Synthase Reductase Length = 539 | Back alignment and structure |
| >pdb|4DQK|A Chain A, Crystal Structure Of The Fad Binding Domain Of Cytochrome P450 Bm3 Length = 391 | Back alignment and structure |
| >pdb|4DQL|A Chain A, Crystal Structure Of The Fad Binding Domain Of Cytochrome P450 Bm3 In Complex With Nadp+ Length = 393 | Back alignment and structure |
| >pdb|1J9Z|A Chain A, Cypor-W677g Length = 622 | Back alignment and structure |
| >pdb|1J9Z|A Chain A, Cypor-W677g Length = 622 | Back alignment and structure |
| >pdb|1AMO|A Chain A, Three-Dimensional Structure Of Nadph-Cytochrome P450 Reductase: Prototype For Fmn-And Fad-Containing Enzymes Length = 615 | Back alignment and structure |
| >pdb|1AMO|A Chain A, Three-Dimensional Structure Of Nadph-Cytochrome P450 Reductase: Prototype For Fmn-And Fad-Containing Enzymes Length = 615 | Back alignment and structure |
| >pdb|1JA0|A Chain A, Cypor-W677x Length = 620 | Back alignment and structure |
| >pdb|1JA0|A Chain A, Cypor-W677x Length = 620 | Back alignment and structure |
| >pdb|3ES9|A Chain A, Nadph-Cytochrome P450 Reductase In An Open Conformation Length = 618 | Back alignment and structure |
| >pdb|3ES9|A Chain A, Nadph-Cytochrome P450 Reductase In An Open Conformation Length = 618 | Back alignment and structure |
| >pdb|1JA1|A Chain A, Cypor-Triple Mutant Length = 622 | Back alignment and structure |
| >pdb|1JA1|A Chain A, Cypor-Triple Mutant Length = 622 | Back alignment and structure |
| >pdb|2BPO|A Chain A, Crystal Structure Of The Yeast Cpr Triple Mutant: D74g, Y75f, K78a. Length = 682 | Back alignment and structure |
| >pdb|2BF4|A Chain A, A Second Fmn-Binding Site In Yeast Nadph-Cytochrome P450 Reductase Suggests A Novel Mechanism Of Electron Transfer By Diflavin Reductases. Length = 682 | Back alignment and structure |
| >pdb|3HR4|A Chain A, Human Inos Reductase And Calmodulin Complex Length = 219 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 707 | |||
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 3e-84 | |
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 7e-50 | |
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 1e-25 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 6e-75 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 1e-38 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 7e-27 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 3e-21 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 5e-74 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 6e-41 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 5e-28 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 4e-23 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 1e-73 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 1e-45 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 9e-30 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 4e-27 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 3e-68 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 9e-35 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 8e-26 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 2e-19 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 4e-60 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 2e-40 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 4e-27 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 1e-22 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 6e-58 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 2e-40 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 4e-29 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 2e-20 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 1e-46 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 2e-41 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 8e-25 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 4e-14 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 4e-38 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 1e-17 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 1e-17 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 5e-37 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 1e-22 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 9e-20 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 1e-36 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 2e-16 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 1e-13 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 1e-36 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 9e-16 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 2e-15 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 1e-34 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 1e-12 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 3e-12 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 2e-31 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 6e-17 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 3e-16 | |
| 3hr4_A | 219 | Nitric oxide synthase, inducible; inducible nitric | 2e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 | Back alignment and structure |
|---|
Score = 279 bits (715), Expect = 3e-84
Identities = 123/300 (41%), Positives = 185/300 (61%), Gaps = 6/300 (2%)
Query: 2 LGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDATQVISS--V 59
L ELGGER+LK+R GDE+CGQE+AFR+WA +VF AC+ FC+ DD + + S
Sbjct: 162 LEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISNDR 221
Query: 60 TLNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTT--LGIQMRK 117
+ + R + A L GLS VH ++V L+ + NL + +R+T + +
Sbjct: 222 SWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKS-SRSTIFVRLHTNG 280
Query: 118 PHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWK 177
+ Y+PGDH+G+F N DLV+ ++ RL + +++++L E +T+ VI +WK
Sbjct: 281 NQELQYQPGDHLGVFPGNHEDLVNALIERLEDAP-PANHVVKVEMLEERNTALGVISNWK 339
Query: 178 PHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRH 237
RLP ++ YLDITTPP P LQ FA+ AT +++ L +L+ YE+W+
Sbjct: 340 DESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKW 399
Query: 238 WRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQ 297
+ P ++EVLE+FPSI +P LL+ QL+ LQPR+YSISSSP +P+E+HLTVA+V+Y T+
Sbjct: 400 GKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTR 459
|
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 | Back alignment and structure |
|---|
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Length = 539 | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Length = 539 | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Length = 539 | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Length = 539 | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Length = 435 | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Length = 435 | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Length = 435 | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Length = 435 | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Length = 458 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Length = 458 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Length = 458 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Length = 458 | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Length = 393 | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Length = 393 | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Length = 393 | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Length = 393 | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Length = 374 | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Length = 374 | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Length = 374 | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Length = 374 | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Length = 304 | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Length = 304 | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Length = 304 | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Length = 314 | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Length = 314 | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Length = 314 | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Length = 402 | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Length = 402 | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Length = 402 | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Length = 311 | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Length = 311 | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Length = 311 | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Length = 314 | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Length = 314 | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Length = 314 | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Length = 316 | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Length = 316 | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Length = 316 | Back alignment and structure |
|---|
| >3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, alternative splicing, calcium, calmodulin-binding, FAD, FMN, heme, iron, metal-binding; HET: FMN; 2.50A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 707 | |||
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 100.0 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 100.0 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 100.0 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 100.0 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 100.0 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 100.0 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 100.0 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 100.0 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 99.97 | |
| 3vo2_A | 310 | Putative uncharacterized protein; rossmann fold, o | 99.97 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 99.97 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 99.97 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 99.95 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 99.95 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 99.94 | |
| 2r6h_A | 290 | NADH:ubiquinone oxidoreductase, Na translocating, | 99.72 | |
| 1tvc_A | 250 | Methane monooxygenase component C, methane monooxy | 99.7 | |
| 1qfj_A | 232 | Protein (flavin reductase); riboflavin, ferredoxin | 99.67 | |
| 1fdr_A | 248 | Flavodoxin reductase; ferredoxin reductase, flavin | 99.67 | |
| 1umk_A | 275 | B5R, NADH-cytochrome B5 reductase; flavoprotein, b | 99.67 | |
| 4eh1_A | 243 | Flavohemoprotein; structural genomics, niaid, nati | 99.66 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 99.65 | |
| 4fk8_A | 271 | Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st | 99.65 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 99.65 | |
| 2bgi_A | 272 | Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi | 99.65 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 99.64 | |
| 2qdx_A | 257 | Ferredoxin reductase; oxidoreductase; HET: FAD; 1. | 99.63 | |
| 4g1v_A | 399 | Flavohemoglobin; three domains: globin fold, antip | 99.63 | |
| 2eix_A | 243 | NADH-cytochrome B5 reductase; flavoprotein, FAD-bi | 99.61 | |
| 2cnd_A | 270 | NADH-dependent nitrate reductase; nitrate assimila | 99.59 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 99.54 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 99.48 | |
| 3a1f_A | 186 | Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi | 98.99 | |
| 2gpj_A | 252 | Siderophore-interacting protein; structural genomi | 98.9 | |
| 3lrx_A | 158 | Putative hydrogenase; alpha-beta protein, structur | 98.83 | |
| 3lyu_A | 142 | Putative hydrogenase; the C-terminal has AN alpha- | 98.73 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 98.61 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 98.48 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 98.48 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 98.45 | |
| 3hr4_A | 219 | Nitric oxide synthase, inducible; inducible nitric | 98.45 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 98.37 | |
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 98.31 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 98.02 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 97.97 | |
| 1bvy_F | 191 | Protein (cytochrome P450 BM-3); fatty acid monooxy | 92.74 |
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-80 Score=725.98 Aligned_cols=511 Identities=38% Similarity=0.689 Sum_probs=425.3
Q ss_pred ChhccCceecccceeccCCCCcHHHHHHHHHHHHHHHHHHcCCCCCCccccc--ccccccccccCceeeeccCCCccccc
Q psy15286 1 MLGELGGERLLKLRAGDEMCGQEQAFRSWAPEVFNVACETFCLDDDETLSDA--TQVISSVTLNASTVRFLPMTTADSLV 78 (707)
Q Consensus 1 ~l~~lGa~r~~~~g~gD~~~g~e~~f~~W~~~l~~~l~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (707)
+|++|||+|++++|+||+++|+|++|+.|.+++|+++++.|+++.......+ ........|....+++........+.
T Consensus 161 ~L~~lGa~rl~~~~~~D~~~g~e~~f~~W~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (688)
T 1tll_A 161 LLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISNDRSWKRNKFRLTYVAEAPDLT 240 (688)
T ss_dssp HHHHTTCEESSCCEEEETTTTHHHHHHHHHHHHHHHHHHHHTCCSSSCCC-------CCSSSCCTTTEEEEECSCCCCHH
T ss_pred HHHHcCCceeecceeeccCCCcHHHHHHHHHHHHHHHHHhcCCCcccccccccccccccccccCCcceEEeccccccccc
Confidence 4789999999999999999999999999999999999999987654322110 00001112333344443322111121
Q ss_pred ccccccCCCCcEEEEEeEEeeccCCCCCCCcEEEEEeeCC--CCCCCCCCCeeEEcccCCHHHHHHHHHHhcCCCCCCCC
Q psy15286 79 TGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKP--HDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDE 156 (707)
Q Consensus 79 ~~~~~~~~~~~~~a~V~~n~~Lt~~~~~~r~v~hiel~l~--~~l~Y~pGD~l~I~P~N~~~~V~~lL~~L~L~~~d~d~ 156 (707)
...+.++.++++.|+|+.|++||+ .+++|+++||+|++. .+++|+|||+|+|+|.|+++.|+++|++|++ ..++|+
T Consensus 241 ~~~~~~~~~~~~~a~v~~~~~Lt~-~~~~~~~~hiel~~~~~~~~~Y~~GD~l~V~P~N~~~~V~~~l~~l~~-~~~~d~ 318 (688)
T 1tll_A 241 QGLSNVHKKRVSAARLLSRQNLQS-PKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLED-APPANH 318 (688)
T ss_dssp HHHHHHTTSCCEEEEEEEEEECSC-TTCSSCEEEEEEECTTCGGGCCCTTCEEEECCCCCHHHHHHHHTTCSS-CCCSCS
T ss_pred ccccccccCCceEEEEEeeeecCC-CCCCceEEEEEEecCCCCCCccCCCCEEEEecCCCHHHHHHHHHHhCC-CCCCCe
Confidence 222345677899999999999999 889999999999983 3799999999999999999999999999985 368999
Q ss_pred ceEecccccccccccccccCCCCCCCCcccHHHHHHHhhccCCCCCHHHHHHHHhhcCCHHHHHHHHHhhhchHHHHHHh
Q psy15286 157 PMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWR 236 (707)
Q Consensus 157 ~i~l~~~~~~~~~~~~~~~~~~~~~~Pp~tl~~ll~~~lDl~~~p~~~~l~~La~~a~d~~ek~~L~~L~s~~~~y~~~~ 236 (707)
.|++...++..+..+..+.|....++|++|++++|++|+||+++|++.||+.||+|++|+.+|++|++|+++.+.|.+|+
T Consensus 319 ~v~~~~~~~~~~p~~~~~~~~~~~~~p~~tl~~~l~~~lDi~~~p~~~~l~~la~~a~~~~ek~~L~~l~~~~~~~~~~~ 398 (688)
T 1tll_A 319 VVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWK 398 (688)
T ss_dssp CEEEEEEEECCCSSSCCEEEEECCSSCSBCHHHHHHHTBCCSSCCCHHHHHHHHTTBCCHHHHHHHHHHTTCSHHHHHHH
T ss_pred EEEEeccccccCCCcccccccccCCCCCccHHHHHHhheeCCCCCCHHHHHHHHHHcCCHHHHHHHHHHhcCHHHHHHHH
Confidence 99987543322112323456666778899999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCHHHHHhhCCCCCCChHHHHHHhCCCCCCcccccCCCCCCCCeEEEEEEEEEeeccCCCCCcccccccccccccc
Q psy15286 237 HWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGASIHSDSAAYEDWRHWRF 316 (707)
Q Consensus 237 ~~~~~slldvL~~f~s~~~pl~~Ll~~lp~l~PR~YSIsSSp~~~p~~i~ltvavv~y~t~~~~~~~r~GlcS~~~~~~~ 316 (707)
...+++++|+|.+||++++|+++++..+|+++||.|||||+|..+++.++|+|++++|.++.|.++.+.|+||+|
T Consensus 399 ~~~~~~i~evl~~fps~~~p~~~l~~~lp~l~~R~YSIsSsp~~~~~~i~l~V~vv~~~~~~g~~~~~~G~~S~~----- 473 (688)
T 1tll_A 399 WGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSW----- 473 (688)
T ss_dssp HHHCCCHHHHHHHSTTBCCCHHHHHHHSCBCCCEEEEBCSCTTTSTTEEEEEEECCEEETGGGTSCEEECHHHHH-----
T ss_pred hhcCCCHHHHHHhCCCcCCCHHHHHHhCcccceeEEeecCCcccCCCeEEEEEEEEEEecCCCCCCcCCCchhHH-----
Confidence 999999999999999999999999999999999999999999988999999999999998876677899999999
Q ss_pred ccHHHHhhhCCCCCCChHHHHhccCCCCceeEEecCCCCCCCCcceeEEEEEeecccccCccCccccccccccccccccC
Q psy15286 317 PHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQGLSKVHSRKVWQCPLIKKWNLYG 396 (707)
Q Consensus 317 ~~~~d~l~~fps~~~~~~~lL~~L~~g~~~~~sIsSs~~~~p~~i~l~v~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 396 (707)
|..+.+|+.+.+++
T Consensus 474 --------------------L~~l~~Gd~v~v~~---------------------------------------------- 487 (688)
T 1tll_A 474 --------------------LNRIQADDVVPCFV---------------------------------------------- 487 (688)
T ss_dssp --------------------HTTCCTTSEEEEEE----------------------------------------------
T ss_pred --------------------HHhCCCCCEEEEEe----------------------------------------------
Confidence 87788777665554
Q ss_pred CCCCCCCcEEEeeccCCCCCCCCCCCCCCceeeecccccCCCCCcccCCCCcccccccCchhhhhhhhhhccCCCCCCCc
Q psy15286 397 SQPVAFAPVTVQFRSDQKDSSRESDGSQPVARTTLGIQMRKPHDCAYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDE 476 (707)
Q Consensus 397 ~~~~~~~~~~~~~r~~~~~f~lp~~~~~Piim~~~~~~~~~~~~~~i~~Gt~~~~~~~~~~~~~~~~~~~~~~~GiAPfr 476 (707)
+++ ..|++|.++..|+|| ||+|| ||||||
T Consensus 488 -------------~p~-g~F~lp~~~~~piIl--------------IagGt-----------------------GIAP~~ 516 (688)
T 1tll_A 488 -------------RGA-PSFHLPRNPQVPCIL--------------VGPGT-----------------------GIAPFR 516 (688)
T ss_dssp -------------ECC-GGGSCCSCTTSCEEE--------------EEEGG-----------------------GGTTHH
T ss_pred -------------ccC-CCcccCcCCCCCEEE--------------EEcCc-----------------------chHHHH
Confidence 221 138899888899999 99999 999999
Q ss_pred hhhhhhhccccCCcccccccccccCCChhhHhhhhhhccccCCCCChhhhhhhhcccCCcchHHHHHHHHHhhhhhhhhh
Q psy15286 477 PMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATKMQNSRVIK 556 (707)
Q Consensus 477 ~~~~~~~~~~~~~~~~~~f~q~~~R~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 556 (707)
+|+| +|. ... +
T Consensus 517 -----------------s~l~--~~~---~~~-----------------------------------------------~ 527 (688)
T 1tll_A 517 -----------------SFWQ--QRQ---FDI-----------------------------------------------Q 527 (688)
T ss_dssp -----------------HHHH--HHH---HHH-----------------------------------------------H
T ss_pred -----------------HHHH--HHH---Hhh-----------------------------------------------h
Confidence 9999 655 210 0
Q ss_pred cccccCCceEEEEecCCCCCc-ccHHHHHHHHhcCCCceEEEEEecCCCCCccchhhHHHhh-HHHHHHHhhcCCcEEEE
Q psy15286 557 FGLQELGKMTLFFGCQLKTMD-LYSDEKSKMLDQKVLTKSFLALSREPTIPKTYVQDLMKKE-ASMLYRELIKEGGHFYV 634 (707)
Q Consensus 557 ~~~~~~g~i~LffG~R~~~~D-ly~dELe~~~~~g~l~~l~~AfSRe~~~~k~YVQd~L~~~-~~~l~~~L~~~ga~iYV 634 (707)
..+...++++||||||+++.| +|.+||++|.+.+.+++++++|||++.+.++||||+|.++ .+.+++++.+.+++|||
T Consensus 528 ~~~~~~~~v~L~~G~R~~~~D~ly~dEL~~~~~~~~~~~l~~a~Sr~~~~~k~yVq~~l~~~l~~~l~~~l~~~~~~vYv 607 (688)
T 1tll_A 528 HKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYV 607 (688)
T ss_dssp HSCCCCCCEEEEEEESCTTTTCTTHHHHHHHHHTTSEEEEEEEESSCTTSCCCCHHHHHHHSSHHHHHHHHHTSCCEEEE
T ss_pred hccCCCCCEEEEEEeccchhhhhHHHHHHHHHHcCCceEEEEEECCCCCCCccchhhhhHHhHHHHHHHhhccCCcEEEE
Confidence 013456899999999999878 9999999999888777899999999754589999999988 78888877567899999
Q ss_pred eCChhhHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhCCcEEEEEecccccchhhhhhhHHHHHHhhhhc
Q psy15286 635 CGDCTMAEHVYQTLKYVFQHEGNLTEQNAEKLLLRLRDENRYHEDIFGITLRTAEVHKSSRESARIRMYQS 705 (707)
Q Consensus 635 CGp~~M~~~V~~~L~~il~~~~~~~~~~a~~~l~~L~~~gRy~~Dvw~~~~~~~~~~~~~~~~~~~~~~~~ 705 (707)
|||++|+++|.++|.+++++++|+++++|++|+++|++++|||.|+|+..++++++|.++|++| +||+.+
T Consensus 608 CGp~~M~~~V~~~L~~i~~~~gg~~~~~a~~~l~~l~~~~ry~~Evf~~~~~~~~~~~~~~~~~-~~~~~~ 677 (688)
T 1tll_A 608 CGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSES-IAFIEE 677 (688)
T ss_dssp EEEHHHHHHHHHHHHHHHHTTTCCCTTHHHHHHHHHHHTTCEEEEEEESCSSHHHHHHHHHHHT-C-----
T ss_pred eCCHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHhhhhcCCEEEEecCCcccchhhhhhhHHHH-HHHHHh
Confidence 9999999999999999999999999999999999999999999999999999999999999999 777754
|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* | Back alignment and structure |
|---|
| >3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* | Back alignment and structure |
|---|
| >2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 | Back alignment and structure |
|---|
| >1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 | Back alignment and structure |
|---|
| >1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* | Back alignment and structure |
|---|
| >1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* | Back alignment and structure |
|---|
| >4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* | Back alignment and structure |
|---|
| >4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 | Back alignment and structure |
|---|
| >2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* | Back alignment and structure |
|---|
| >4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* | Back alignment and structure |
|---|
| >2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} | Back alignment and structure |
|---|
| >3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* | Back alignment and structure |
|---|
| >3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* | Back alignment and structure |
|---|
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* | Back alignment and structure |
|---|
| >1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 707 | ||||
| d1f20a1 | 270 | b.43.4.1 (A:963-1232) Neuronal nitric-oxide syntha | 4e-55 | |
| d1f20a1 | 270 | b.43.4.1 (A:963-1232) Neuronal nitric-oxide syntha | 1e-23 | |
| d1ja1a1 | 279 | b.43.4.1 (A:240-518) NADPH-cytochrome p450 reducta | 5e-42 | |
| d1ja1a1 | 279 | b.43.4.1 (A:240-518) NADPH-cytochrome p450 reducta | 5e-18 | |
| d1ja1a1 | 279 | b.43.4.1 (A:240-518) NADPH-cytochrome p450 reducta | 2e-14 | |
| d1ddga1 | 221 | b.43.4.1 (A:226-446) Sulfite reductase flavoprotei | 3e-28 | |
| d1ddga1 | 221 | b.43.4.1 (A:226-446) Sulfite reductase flavoprotei | 8e-15 | |
| d1ddga1 | 221 | b.43.4.1 (A:226-446) Sulfite reductase flavoprotei | 3e-07 | |
| d1f20a2 | 165 | c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synth | 4e-25 | |
| d1ja1a3 | 160 | c.25.1.4 (A:519-678) NADPH-cytochrome p450 reducta | 2e-23 | |
| d1ddga2 | 153 | c.25.1.4 (A:447-599) Sulfite reductase flavoprotei | 4e-17 | |
| d1fnda2 | 160 | c.25.1.1 (A:155-314) Ferredoxin reductase (flavodo | 3e-15 | |
| d1jb9a2 | 154 | c.25.1.1 (A:163-316) Ferredoxin reductase (flavodo | 3e-14 | |
| d2bmwa2 | 162 | c.25.1.1 (A:142-303) Ferredoxin reductase (flavodo | 2e-12 | |
| d1tlla2 | 202 | c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FM | 5e-09 | |
| d1jb9a1 | 157 | b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxi | 7e-09 | |
| d1jb9a1 | 157 | b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxi | 8e-09 | |
| d1ja1a2 | 177 | c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductas | 2e-07 | |
| d1bvyf_ | 152 | c.23.5.1 (F:) FMN-binding domain of the cytochrome | 2e-04 |
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 270 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Riboflavin synthase domain-like family: NADPH-cytochrome p450 reductase FAD-binding domain-like domain: Neuronal nitric-oxide synthase FAD/NADP+ domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 187 bits (476), Expect = 4e-55
Identities = 92/235 (39%), Positives = 144/235 (61%), Gaps = 4/235 (1%)
Query: 64 STVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRKPHD--C 121
+ R + A L GLS VH ++V L+ + NL + +R+T+ +++ +
Sbjct: 5 NKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKS-SRSTIFVRLHTNGNQEL 63
Query: 122 AYEPGDHVGIFASNKWDLVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHER 181
Y+PGDH+G+F N DLV+ ++ RL + +++++L E +T+ VI +WK R
Sbjct: 64 QYQPGDHLGVFPGNHEDLVNALIERLEDAP-PANHVVKVEMLEERNTALGVISNWKDESR 122
Query: 182 LPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDDQEILTLLATDSAAYEDWRHWRFP 241
LP ++ YLDITTPP P LQ FA+ AT +++ L +L+ YE+W+ + P
Sbjct: 123 LPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNP 182
Query: 242 HLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRT 296
++EVLE+FPSI +P LL+ QL+ LQPR+YSISSSP +P+E+HLTVA+V+Y T
Sbjct: 183 TMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHT 237
|
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 270 | Back information, alignment and structure |
|---|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 279 | Back information, alignment and structure |
|---|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 279 | Back information, alignment and structure |
|---|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 279 | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Length = 221 | Back information, alignment and structure |
|---|
| >d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 160 | Back information, alignment and structure |
|---|
| >d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 160 | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 154 | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Length = 162 | Back information, alignment and structure |
|---|
| >d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 202 | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 157 | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 157 | Back information, alignment and structure |
|---|
| >d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 707 | |||
| d1f20a1 | 270 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 100.0 | |
| d1ja1a1 | 279 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 100.0 | |
| d1ddga1 | 221 | Sulfite reductase flavoprotein {Escherichia coli [ | 100.0 | |
| d1ja1a3 | 160 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 100.0 | |
| d1f20a2 | 165 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 99.97 | |
| d1ddga2 | 153 | Sulfite reductase flavoprotein {Escherichia coli [ | 99.94 | |
| d1fnda2 | 160 | Ferredoxin reductase (flavodoxin reductase) {Spina | 99.92 | |
| d1jb9a2 | 154 | Ferredoxin reductase (flavodoxin reductase) {Maize | 99.91 | |
| d2bmwa2 | 162 | Ferredoxin reductase (flavodoxin reductase) {Cyano | 99.89 | |
| d1jb9a1 | 157 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.69 | |
| d1tvca2 | 141 | Methane monooxygenase component C, MmoC {Methyloco | 99.69 | |
| d1krha2 | 133 | Benzoate dioxygenase reductase {Acinetobacter sp. | 99.65 | |
| d1fdra2 | 148 | Ferredoxin reductase (flavodoxin reductase) {Esche | 99.6 | |
| d1cqxa3 | 142 | Flavohemoglobin, C-terminal domain {Alcaligenes eu | 99.55 | |
| d1gvha3 | 143 | Flavohemoglobin, C-terminal domain {Escherichia co | 99.55 | |
| d1qfja2 | 135 | NAD(P)H:flavin oxidoreductase {Escherichia coli [T | 99.5 | |
| d1fnda1 | 136 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.44 | |
| d2piaa2 | 120 | Phthalate dioxygenase reductase {Pseudomonas cepac | 99.38 | |
| d1f20a1 | 270 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 99.37 | |
| d1umka2 | 147 | cytochrome b5 reductase {Human (Homo sapiens) [Tax | 99.35 | |
| d1ja1a1 | 279 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 99.33 | |
| d1a8pa2 | 158 | Ferredoxin reductase (flavodoxin reductase) {Azoto | 99.32 | |
| d2cnda2 | 146 | Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | 99.26 | |
| d1ddga1 | 221 | Sulfite reductase flavoprotein {Escherichia coli [ | 99.23 | |
| d2bmwa1 | 133 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.13 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 98.76 | |
| d1jb9a1 | 157 | Ferredoxin reductase (flavodoxin reductase) N-term | 96.64 | |
| d1fdra1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 92.3 | |
| d1a8pa1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 90.17 | |
| d1fnda1 | 136 | Ferredoxin reductase (flavodoxin reductase) N-term | 88.07 | |
| d1cqxa2 | 111 | Flavohemoglobin, central domain {Alcaligenes eutro | 87.4 | |
| d1tvca1 | 109 | Methane monooxygenase component C, MmoC {Methyloco | 87.23 | |
| d2piaa1 | 103 | Phthalate dioxygenase reductase {Pseudomonas cepac | 85.47 | |
| d2cnda1 | 114 | Nitrate reductase core domain {Corn (Zea mays) [Ta | 85.32 |
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Riboflavin synthase domain-like family: NADPH-cytochrome p450 reductase FAD-binding domain-like domain: Neuronal nitric-oxide synthase FAD/NADP+ domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=6.6e-51 Score=424.00 Aligned_cols=267 Identities=35% Similarity=0.624 Sum_probs=235.7
Q ss_pred ccCceeeeccCCCcccccccccccCCCCcEEEEEeEEeeccCCCCCCCcEEEEEeeC-C-CCCCCCCCCeeEEcccCCHH
Q psy15286 61 LNASTVRFLPMTTADSLVTGLSKVHSRKVWQCPLIKKWNLYGSQPVARTTLGIQMRK-P-HDCAYEPGDHVGIFASNKWD 138 (707)
Q Consensus 61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~V~~n~~Lt~~~~~~r~v~hiel~l-~-~~l~Y~pGD~l~I~P~N~~~ 138 (707)
|.++++++....+..++..+++.+++++++.|+|+.|++|++ ++++|+++||||++ + ++++|+|||+|+|+|.|+++
T Consensus 2 w~~~~~~~~~~~~~~~~~~~~s~~~~k~~~~a~v~~~~~L~~-~~s~r~t~hield~~g~~~l~Y~~GD~l~V~P~N~~~ 80 (270)
T d1f20a1 2 WKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQS-PKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHED 80 (270)
T ss_dssp CCTTSEEEEECSCCCCHHHHHHHHHTSCCEEEEEEEEEECSC-TTCSSCEEEEEEECTTCGGGCCCTTCEEEECCCCCHH
T ss_pred CCCCeEEEEecCCCcccccchhhhccCCcEeeEEEEEEeccC-CCCCccEEEEEEEcCCCCCCeEcCCCEEEEEeCCCHH
Confidence 566777777766555566667778899999999999999999 89999999999999 3 47999999999999999999
Q ss_pred HHHHHHHHhcCCCCCCCCceEecccccccccccccccCCCCCCCCcccHHHHHHHhhccCCCCCHHHHHHHHhhcCCHHH
Q psy15286 139 LVSGILARLNLGGIDPDEPMELQVLSETHTSTEVIKSWKPHERLPRASLRTLLSRYLDITTPPPPALLQFFATFATAPDD 218 (707)
Q Consensus 139 ~V~~lL~~L~L~~~d~d~~i~l~~~~~~~~~~~~~~~~~~~~~~Pp~tl~~ll~~~lDl~~~p~~~~l~~La~~a~d~~e 218 (707)
.|++++++|||. .+.+..|.+.......+..+....|.....+||+|++++|++|+||+++|++.+|+.||+|++|+.+
T Consensus 81 ~V~~~l~~lgl~-~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~p~tl~~~l~~~~Di~~~p~~~~l~~La~~~~~~~e 159 (270)
T d1f20a1 81 LVNALIERLEDA-PPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKE 159 (270)
T ss_dssp HHHHHHTTBSSC-CCTTSCEEEEEEEEESSSTTCEEEEEECCSSCSBCHHHHHHHTBCCSSCCCHHHHHHHHTTBCCHHH
T ss_pred HHHHHHHHhCCC-CccCEEEEeeecccccccccccccccccCCCCCccHHHHHHhheecccCCCHHHHHHHHHHCCCHHH
Confidence 999999999964 5667778776544332222223445445566699999999999999999999999999999999999
Q ss_pred HHHHHHhhhchHHHHHHhhcCCCCHHHHHhhCCCCCCChHHHHHHhCCCCCCcccccCCCCCCCCeEEEEEEEEEeeccC
Q psy15286 219 QEILTLLATDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSPLAHPNEIHLTVAVVTYRTQG 298 (707)
Q Consensus 219 k~~L~~L~s~~~~y~~~~~~~~~slldvL~~f~s~~~pl~~Ll~~lp~l~PR~YSIsSSp~~~p~~i~ltvavv~y~t~~ 298 (707)
|++|++++++.+.|++|+..++++++|+|++||++++|++.|++++|+|+||+|||||||+.+|+++||||++|+|.+.+
T Consensus 160 k~~L~~l~~~~~~~~~~~~~~~~tlldvL~~fps~~~pl~~ll~~lp~L~PR~YSIsSSp~~~p~~v~Ltv~vV~y~~~~ 239 (270)
T d1f20a1 160 KQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRD 239 (270)
T ss_dssp HHHHHHHTTCSHHHHHHHHHHCCCHHHHHHHSTTBCBCHHHHHHHSCBCCCEEEECCSCTTTSTTEEEEEEECCEEECGG
T ss_pred HHHHHhhcccHHHHHHHHhccCCcHHHHHHhccccCCCHHHHHHhccccccceeEEecCccCCCCEEEEEEEEEEEeccC
Confidence 99999999998999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCCCccccccccccccccccHHHHhhhCCCCCCChHHHHhccCCCCceeEEecCCC
Q psy15286 299 ASIHSDSAAYEDWRHWRFPHLLEVLEQFPSIHLPPALLVAQLTPLQPRFYSISSSP 354 (707)
Q Consensus 299 ~~~~~r~GlcS~~~~~~~~~~~d~l~~fps~~~~~~~lL~~L~~g~~~~~sIsSs~ 354 (707)
|.++.|.|+||+| |++|.+|+.+.++|..||
T Consensus 240 ~~g~~r~GvcS~~-------------------------L~~l~~Gd~v~v~vr~sP 270 (270)
T d1f20a1 240 GEGPVHHGVCSSW-------------------------LNRIQADDVVPCFVRGAP 270 (270)
T ss_dssp GTSCEEECHHHHH-------------------------HTTCCTTCEEEEEEECCT
T ss_pred CCCCeeeeechHH-------------------------HhcCCCCCEEEEEEecCC
Confidence 8888999999999 999999999999996553
|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|