Diaphorina citri psyllid: psy15292


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MFKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSLSSAIPTYVSISNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHAGHKER
cEEEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEcccHHHHHHccccCCccccccCEEcccccCEEEEcccEEEcccccccccccc
MFKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSLSSAIPTYVSISNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRT********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSLSSAIPTYVSISNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHAGHKER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0009891 [BP]positive regulation of biosynthetic processprobableGO:0009893, GO:0019222, GO:0009889, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0051246 [BP]regulation of protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030193 [BP]regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0048583, GO:1900046, GO:0061041, GO:0065007, GO:0051239, GO:0008150, GO:0050818, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XXL, chain A
Confidence level:very confident
Coverage over the Query: 2-127
View the alignment between query and template
View the model in PyMOL