Psyllid ID: psy15292
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| 328717744 | 602 | PREDICTED: coagulation factor IX-like [A | 0.537 | 0.117 | 0.675 | 4e-22 | |
| 383857605 | 780 | PREDICTED: uncharacterized protein LOC10 | 0.575 | 0.097 | 0.576 | 3e-21 | |
| 157123330 | 570 | serine protease [Aedes aegypti] gi|10888 | 0.515 | 0.119 | 0.642 | 5e-21 | |
| 170049513 | 413 | serine protease [Culex quinquefasciatus] | 0.583 | 0.186 | 0.604 | 6e-21 | |
| 158299684 | 248 | AGAP008997-PA [Anopheles gambiae str. PE | 0.537 | 0.286 | 0.647 | 7e-21 | |
| 312383975 | 253 | hypothetical protein AND_02726 [Anophele | 0.537 | 0.280 | 0.647 | 7e-21 | |
| 328776525 | 787 | PREDICTED: hypothetical protein LOC41040 | 0.590 | 0.099 | 0.564 | 8e-21 | |
| 350426707 | 792 | PREDICTED: hypothetical protein LOC10074 | 0.590 | 0.098 | 0.551 | 1e-20 | |
| 194753634 | 554 | GF12720 [Drosophila ananassae] gi|190620 | 0.553 | 0.131 | 0.618 | 1e-20 | |
| 340723576 | 793 | PREDICTED: hypothetical protein LOC10065 | 0.590 | 0.098 | 0.551 | 1e-20 |
| >gi|328717744|ref|XP_001943624.2| PREDICTED: coagulation factor IX-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 109 bits (272), Expect = 4e-22, Method: Compositional matrix adjust.
Identities = 50/74 (67%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
Query: 3 KLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWG 62
+ N + VHPQYSP+DFRNDVAL+KID DV +KQHIIPVCLP KLVGK+ATVAGWG
Sbjct: 435 EFNVERKEVHPQYSPTDFRNDVALVKIDHDVTYKQHIIPVCLPSSAAKLVGKTATVAGWG 494
Query: 63 RTRHASSLSSAIPT 76
RTRH S +PT
Sbjct: 495 RTRHG---VSTVPT 505
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383857605|ref|XP_003704295.1| PREDICTED: uncharacterized protein LOC100882186 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|157123330|ref|XP_001660119.1| serine protease [Aedes aegypti] gi|108884512|gb|EAT48737.1| AAEL000238-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170049513|ref|XP_001857207.1| serine protease [Culex quinquefasciatus] gi|167871326|gb|EDS34709.1| serine protease [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158299684|ref|XP_319746.4| AGAP008997-PA [Anopheles gambiae str. PEST] gi|157013635|gb|EAA43365.4| AGAP008997-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312383975|gb|EFR28831.1| hypothetical protein AND_02726 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|328776525|ref|XP_393882.3| PREDICTED: hypothetical protein LOC410402 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350426707|ref|XP_003494519.1| PREDICTED: hypothetical protein LOC100740075 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|194753634|ref|XP_001959115.1| GF12720 [Drosophila ananassae] gi|190620413|gb|EDV35937.1| GF12720 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|340723576|ref|XP_003400165.1| PREDICTED: hypothetical protein LOC100652014 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| FB|FBgn0033362 | 561 | CG8172 [Drosophila melanogaste | 0.553 | 0.130 | 0.631 | 2.6e-20 | |
| UNIPROTKB|F1SUG2 | 632 | PRSS22 "Uncharacterized protei | 0.386 | 0.080 | 0.396 | 2.2e-14 | |
| UNIPROTKB|I3LDL1 | 1047 | TMPRSS9 "Uncharacterized prote | 0.590 | 0.074 | 0.341 | 1.9e-13 | |
| UNIPROTKB|E1B9Z9 | 1095 | TMPRSS9 "Uncharacterized prote | 0.507 | 0.061 | 0.367 | 4.3e-13 | |
| RGD|1309581 | 1061 | Tmprss9 "transmembrane proteas | 0.590 | 0.073 | 0.341 | 1.1e-12 | |
| UNIPROTKB|F1PXI5 | 581 | PRSS42 "Uncharacterized protei | 0.507 | 0.115 | 0.333 | 1.6e-05 | |
| FB|FBgn0033359 | 1693 | CG8213 [Drosophila melanogaste | 0.530 | 0.041 | 0.4 | 3.5e-12 | |
| UNIPROTKB|I3L9G9 | 655 | I3L9G9 "Uncharacterized protei | 0.719 | 0.145 | 0.265 | 2.5e-05 | |
| ZFIN|ZDB-GENE-030131-1171 | 459 | ctrb1 "chymotrypsinogen B1" [D | 0.446 | 0.128 | 0.35 | 0.00011 | |
| UNIPROTKB|Q7Z410 | 1059 | TMPRSS9 "Transmembrane proteas | 0.507 | 0.063 | 0.323 | 3.1e-11 |
| FB|FBgn0033362 CG8172 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 2.6e-20, P = 2.6e-20
Identities = 48/76 (63%), Positives = 57/76 (75%)
Query: 11 VHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSL 70
VHP Y+P+DF NDVALI++D++VV+KQHIIPVCLP T KL GK ATVAGWGRTRH S
Sbjct: 398 VHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQST 457
Query: 71 SSAIPTYVS---ISND 83
++ V ISND
Sbjct: 458 VPSVLQEVDVEVISND 473
|
|
| UNIPROTKB|F1SUG2 PRSS22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDL1 TMPRSS9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B9Z9 TMPRSS9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1309581 Tmprss9 "transmembrane protease, serine 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXI5 PRSS42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033359 CG8213 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L9G9 I3L9G9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1171 ctrb1 "chymotrypsinogen B1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z410 TMPRSS9 "Transmembrane protease serine 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 132 | |||
| cd00190 | 232 | cd00190, Tryp_SPc, Trypsin-like serine protease; M | 1e-18 | |
| smart00020 | 229 | smart00020, Tryp_SPc, Trypsin-like serine protease | 8e-17 | |
| cd00190 | 232 | cd00190, Tryp_SPc, Trypsin-like serine protease; M | 6e-12 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 8e-12 | |
| smart00020 | 229 | smart00020, Tryp_SPc, Trypsin-like serine protease | 9e-11 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 6e-09 |
| >gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
Score = 78.1 bits (193), Expect = 1e-18
Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
Query: 3 KLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKL-VGKSATVAGW 61
+ ++ VHP Y+PS + ND+AL+K+ + V ++ P+CLP L G + TV+GW
Sbjct: 70 VIKVKKVIVHPNYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGW 129
Query: 62 GRTRHASSLSS 72
GRT L
Sbjct: 130 GRTSEGGPLPD 140
|
Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232 |
| >gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| KOG3627|consensus | 256 | 99.68 | ||
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.57 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 99.52 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.31 | |
| KOG3627|consensus | 256 | 97.73 | ||
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 97.69 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 97.21 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 97.05 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 96.85 | |
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 95.37 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 94.35 |
| >KOG3627|consensus | Back alignment and domain information |
|---|
Probab=99.68 E-value=6.9e-16 Score=99.72 Aligned_cols=123 Identities=27% Similarity=0.450 Sum_probs=91.0
Q ss_pred EEeeeEEEeCCCCCCCCCC-CceEEEEeCCCeeeCCCeeeeeecCCCC---cccCCcEEEeccCccccCCCcccccceee
Q psy15292 3 KLNTRQSFVHPQYSPSDFR-NDVALIKIDKDVVFKQHIIPVCLPDQTV---KLVGKSATVAGWGRTRHASSLSSAIPTYV 78 (132)
Q Consensus 3 ~~~v~~~~~h~~y~~~~~~-~diall~l~~~~~~~~~~~~~cl~~~~~---~~~g~~~~~~GwG~~~~~~~~~~~~l~~~ 78 (132)
...+.++++||+|+..... ||||||+|.+++.|++.++|+|||.... ...+..|.++|||.+..........++++
T Consensus 86 ~~~v~~~i~H~~y~~~~~~~nDiall~l~~~v~~~~~i~piclp~~~~~~~~~~~~~~~v~GWG~~~~~~~~~~~~L~~~ 165 (256)
T KOG3627|consen 86 VGDVEKIIVHPNYNPRTLENNDIALLRLSEPVTFSSHIQPICLPSSADPYFPPGGTTCLVSGWGRTESGGGPLPDTLQEV 165 (256)
T ss_pred hceeeEEEECCCCCCCCCCCCCEEEEEECCCcccCCcccccCCCCCcccCCCCCCCEEEEEeCCCcCCCCCCCCceeEEE
Confidence 3447788899999998877 9999999999999999999999985543 22457899999999876533446667754
Q ss_pred e---ccCCeEEEEeccc--e----ee-c--cCeeeeecCCCCCCC--C----CceEEEEeecccC
Q psy15292 79 S---ISNDVALIKIDKD--V----VF-K--QHIIPVCLPDQTVKL--V----GKSATVAGWGRTR 125 (132)
Q Consensus 79 ~---~~~d~c~~~~~~~--~----~~-~--~~v~~icl~~~~~~~--~----g~~~~v~gwg~~~ 125 (132)
. ++++.|...+... + .. . ......|.++++.++ . ...+.|..||...
T Consensus 166 ~v~i~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~~~~~~GivS~G~~~ 230 (256)
T KOG3627|consen 166 DVPIISNSECRRAYGGLGTITDTMLCAGGPEGGKDACQGDSGGPLVCEDNGRWVLVGIVSWGSGG 230 (256)
T ss_pred EEeEcChhHhcccccCccccCCCEEeeCccCCCCccccCCCCCeEEEeeCCcEEEEEEEEecCCC
Confidence 4 7778898776542 1 11 1 122336888888777 3 4889999999863
|
|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3627|consensus | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 132 | ||||
| 3f6u_H | 240 | Crystal Structure Of Human Activated Protein C (Apc | 1e-08 | ||
| 1aut_C | 250 | Human Activated Protein C Length = 250 | 1e-08 | ||
| 4igd_A | 406 | Crystal Structure Of The Zymogen Catalytic Region O | 3e-08 | ||
| 3gov_B | 251 | Crystal Structure Of The Catalytic Region Of Human | 3e-08 | ||
| 2olg_A | 278 | Crystal Structure Of The Serine Protease Domain Of | 9e-08 | ||
| 2olg_A | 278 | Crystal Structure Of The Serine Protease Domain Of | 5e-07 | ||
| 2xxl_A | 408 | Crystal Structure Of Drosophila Grass Clip Serine P | 5e-07 | ||
| 2xxl_A | 408 | Crystal Structure Of Drosophila Grass Clip Serine P | 1e-04 | ||
| 2pux_B | 258 | Crystal Structure Of Murine Thrombin In Complex Wit | 6e-07 | ||
| 2pux_B | 258 | Crystal Structure Of Murine Thrombin In Complex Wit | 7e-05 | ||
| 2ocv_B | 259 | Structural Basis Of Na+ Activation Mimicry In Murin | 6e-07 | ||
| 2ocv_B | 259 | Structural Basis Of Na+ Activation Mimicry In Murin | 7e-05 | ||
| 3edx_B | 258 | Crystal Structure Of The W215aE217A MUTANT OF MURIN | 6e-07 | ||
| 3edx_B | 258 | Crystal Structure Of The W215aE217A MUTANT OF MURIN | 7e-05 | ||
| 3r3g_B | 259 | Structure Of Human Thrombin With Residues 145-150 O | 7e-07 | ||
| 3r3g_B | 259 | Structure Of Human Thrombin With Residues 145-150 O | 5e-05 | ||
| 1ym0_A | 238 | Crystal Structure Of Earthworm Fibrinolytic Enzyme | 1e-06 | ||
| 3nxp_A | 424 | Crystal Structure Of Human Prethrombin-1 Length = 4 | 1e-06 | ||
| 3nxp_A | 424 | Crystal Structure Of Human Prethrombin-1 Length = 4 | 1e-04 | ||
| 1nu9_A | 291 | Staphylocoagulase-prethrombin-2 Complex Length = 29 | 2e-06 | ||
| 1nu9_A | 291 | Staphylocoagulase-prethrombin-2 Complex Length = 29 | 1e-04 | ||
| 1hag_E | 295 | The Isomorphous Structures Of Prethrombin2, Hirugen | 2e-06 | ||
| 1hag_E | 295 | The Isomorphous Structures Of Prethrombin2, Hirugen | 1e-04 | ||
| 3t2n_A | 372 | Human Hepsin Protease In Complex With The Fab Fragm | 2e-06 | ||
| 3sqe_E | 290 | Crystal Structure Of Prethrombin-2 Mutant S195a In | 2e-06 | ||
| 3sqe_E | 290 | Crystal Structure Of Prethrombin-2 Mutant S195a In | 1e-04 | ||
| 1z8g_A | 372 | Crystal Structure Of The Extracellular Region Of Th | 2e-06 | ||
| 2bdy_A | 289 | Thrombin In Complex With Inhibitor Length = 289 | 2e-06 | ||
| 2bdy_A | 289 | Thrombin In Complex With Inhibitor Length = 289 | 1e-04 | ||
| 1nm6_A | 287 | Thrombin In Complex With Selective Macrocyclic Inhi | 2e-06 | ||
| 1nm6_A | 287 | Thrombin In Complex With Selective Macrocyclic Inhi | 1e-04 | ||
| 1eoj_A | 289 | Design Of P1' And P3' Residues Of Trivalent Thrombi | 2e-06 | ||
| 1eoj_A | 289 | Design Of P1' And P3' Residues Of Trivalent Thrombi | 1e-04 | ||
| 1o5e_H | 255 | Dissecting And Designing Inhibitor Selectivity Dete | 2e-06 | ||
| 1jwt_A | 305 | Crystal Structure Of Thrombin In Complex With A Nov | 2e-06 | ||
| 1jwt_A | 305 | Crystal Structure Of Thrombin In Complex With A Nov | 1e-04 | ||
| 1d9i_A | 288 | Structure Of Thrombin Complexed With Selective Non- | 2e-06 | ||
| 1d9i_A | 288 | Structure Of Thrombin Complexed With Selective Non- | 1e-04 | ||
| 3k65_B | 308 | Crystal Structure Of Prethombin-2FRAGMENT-2 Complex | 2e-06 | ||
| 3k65_B | 308 | Crystal Structure Of Prethombin-2FRAGMENT-2 Complex | 1e-04 | ||
| 1mh0_A | 287 | Crystal Structure Of The Anticoagulant Slow Form Of | 2e-06 | ||
| 1mh0_A | 287 | Crystal Structure Of The Anticoagulant Slow Form Of | 1e-04 | ||
| 1d6w_A | 287 | Structure Of Thrombin Complexed With Selective Non- | 2e-06 | ||
| 1d6w_A | 287 | Structure Of Thrombin Complexed With Selective Non- | 1e-04 | ||
| 1b7x_B | 259 | Structure Of Human Alpha-Thrombin Y225i Mutant Boun | 2e-06 | ||
| 1b7x_B | 259 | Structure Of Human Alpha-Thrombin Y225i Mutant Boun | 2e-04 | ||
| 1jou_B | 259 | Crystal Structure Of Native S195a Thrombin With An | 2e-06 | ||
| 1jou_B | 259 | Crystal Structure Of Native S195a Thrombin With An | 1e-04 | ||
| 1twx_B | 259 | Crystal Structure Of The Thrombin Mutant D221aD222K | 2e-06 | ||
| 1twx_B | 259 | Crystal Structure Of The Thrombin Mutant D221aD222K | 1e-04 | ||
| 1dx5_M | 259 | Crystal Structure Of The Thrombin-Thrombomodulin Co | 2e-06 | ||
| 1dx5_M | 259 | Crystal Structure Of The Thrombin-Thrombomodulin Co | 1e-04 | ||
| 1dm4_B | 260 | Ser195ala Mutant Of Human Thrombin Complexed With F | 2e-06 | ||
| 1dm4_B | 260 | Ser195ala Mutant Of Human Thrombin Complexed With F | 2e-04 | ||
| 2pgb_B | 259 | Inhibitor-Free Human Thrombin Mutant C191a-C220a Le | 2e-06 | ||
| 2pgb_B | 259 | Inhibitor-Free Human Thrombin Mutant C191a-C220a Le | 1e-04 | ||
| 1bth_H | 259 | Structure Of Thrombin Complexed With Bovine Pancrea | 2e-06 | ||
| 1bth_H | 259 | Structure Of Thrombin Complexed With Bovine Pancrea | 2e-04 | ||
| 1tq0_B | 257 | Crystal Structure Of The Potent Anticoagulant Throm | 2e-06 | ||
| 1tq0_B | 257 | Crystal Structure Of The Potent Anticoagulant Throm | 1e-04 | ||
| 3ee0_B | 259 | Crystal Structure Of The W215aE217A MUTANT OF HUMAN | 2e-06 | ||
| 3ee0_B | 259 | Crystal Structure Of The W215aE217A MUTANT OF HUMAN | 1e-04 | ||
| 1gj5_H | 258 | Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 | 2e-06 | ||
| 1gj5_H | 258 | Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 | 2e-04 | ||
| 1abi_H | 259 | Structure Of The Hirulog 3-Thrombin Complex And Nat | 2e-06 | ||
| 1abi_H | 259 | Structure Of The Hirulog 3-Thrombin Complex And Nat | 2e-04 | ||
| 1wbg_B | 259 | Active Site Thrombin Inhibitors Length = 259 | 2e-06 | ||
| 1wbg_B | 259 | Active Site Thrombin Inhibitors Length = 259 | 2e-04 | ||
| 1mbq_A | 220 | Anionic Trypsin From Pacific Chum Salmon Length = 2 | 2e-06 | ||
| 1mbq_A | 220 | Anionic Trypsin From Pacific Chum Salmon Length = 2 | 2e-04 | ||
| 2thf_B | 259 | Structure Of Human Alpha-thrombin Y225f Mutant Boun | 2e-06 | ||
| 2thf_B | 259 | Structure Of Human Alpha-thrombin Y225f Mutant Boun | 1e-04 | ||
| 1sfq_B | 259 | Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack | 2e-06 | ||
| 1sfq_B | 259 | Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack | 1e-04 | ||
| 1qur_H | 257 | Human Alpha-Thrombin In Complex With Bivalent, Benz | 2e-06 | ||
| 1qur_H | 257 | Human Alpha-Thrombin In Complex With Bivalent, Benz | 1e-04 | ||
| 2od3_B | 259 | Human Thrombin Chimera With Human Residues 184a, 18 | 2e-06 | ||
| 2od3_B | 259 | Human Thrombin Chimera With Human Residues 184a, 18 | 2e-04 | ||
| 1z8i_B | 259 | Crystal Structure Of The Thrombin Mutant G193a Boun | 2e-06 | ||
| 1z8i_B | 259 | Crystal Structure Of The Thrombin Mutant G193a Boun | 2e-04 | ||
| 1rd3_B | 259 | 2.5a Structure Of Anticoagulant Thrombin Variant E2 | 2e-06 | ||
| 1rd3_B | 259 | 2.5a Structure Of Anticoagulant Thrombin Variant E2 | 2e-04 | ||
| 1thp_B | 259 | Structure Of Human Alpha-Thrombin Y225p Mutant Boun | 2e-06 | ||
| 1thp_B | 259 | Structure Of Human Alpha-Thrombin Y225p Mutant Boun | 2e-04 | ||
| 2a0q_B | 257 | Structure Of Thrombin In 400 Mm Potassium Chloride | 2e-06 | ||
| 2a0q_B | 257 | Structure Of Thrombin In 400 Mm Potassium Chloride | 2e-04 | ||
| 1z8j_B | 259 | Crystal Structure Of The Thrombin Mutant G193p Boun | 2e-06 | ||
| 1z8j_B | 259 | Crystal Structure Of The Thrombin Mutant G193p Boun | 1e-04 | ||
| 1vr1_H | 261 | Specifity For Plasminogen Activator Inhibitor-1 Len | 2e-06 | ||
| 1vr1_H | 261 | Specifity For Plasminogen Activator Inhibitor-1 Len | 1e-04 | ||
| 2hnt_E | 81 | Crystallographic Structure Of Human Gamma-Thrombin | 2e-06 | ||
| 2hnt_E | 81 | Crystallographic Structure Of Human Gamma-Thrombin | 1e-04 | ||
| 2b9l_A | 394 | Crystal Structure Of Prophenoloxidase Activating Fa | 2e-06 | ||
| 3tvj_B | 242 | Catalytic Fragment Of Masp-2 In Complex With Its Sp | 2e-06 | ||
| 3tvj_B | 242 | Catalytic Fragment Of Masp-2 In Complex With Its Sp | 2e-04 | ||
| 4fxg_H | 242 | Complement C4 In Complex With Masp-2 Length = 242 | 2e-06 | ||
| 4fxg_H | 242 | Complement C4 In Complex With Masp-2 Length = 242 | 2e-04 | ||
| 1q3x_A | 328 | Crystal Structure Of The Catalytic Region Of Human | 2e-06 | ||
| 1q3x_A | 328 | Crystal Structure Of The Catalytic Region Of Human | 2e-04 | ||
| 1bhx_B | 147 | X-Ray Structure Of The Complex Of Human Alpha Throm | 3e-06 | ||
| 1bhx_B | 147 | X-Ray Structure Of The Complex Of Human Alpha Throm | 1e-04 | ||
| 2zps_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 3 From | 3e-06 | ||
| 2zps_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 3 From | 4e-04 | ||
| 1h8i_H | 253 | X-Ray Crystal Structure Of Human Alpha-Thrombin Wit | 3e-06 | ||
| 1h8i_H | 253 | X-Ray Crystal Structure Of Human Alpha-Thrombin Wit | 1e-04 | ||
| 1vzq_H | 250 | Complex Of Thrombin With Designed Inhibitor 7165 Le | 3e-06 | ||
| 1vzq_H | 250 | Complex Of Thrombin With Designed Inhibitor 7165 Le | 2e-05 | ||
| 1utj_A | 242 | Trypsin Specificity As Elucidated By Lie Calculatio | 3e-06 | ||
| 1utj_A | 242 | Trypsin Specificity As Elucidated By Lie Calculatio | 5e-04 | ||
| 1bit_A | 237 | The Crystal Structure Of Anionic Salmon Trypsin In | 3e-06 | ||
| 1bit_A | 237 | The Crystal Structure Of Anionic Salmon Trypsin In | 5e-04 | ||
| 3gic_B | 250 | Structure Of Thrombin Mutant Delta(146-149e) In The | 3e-06 | ||
| 3gic_B | 250 | Structure Of Thrombin Mutant Delta(146-149e) In The | 2e-04 | ||
| 1bzx_E | 222 | The Crystal Structure Of Anionic Salmon Trypsin In | 3e-06 | ||
| 1bzx_E | 222 | The Crystal Structure Of Anionic Salmon Trypsin In | 5e-04 | ||
| 1hj8_A | 222 | 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | 3e-06 | ||
| 1hj8_A | 222 | 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | 5e-04 | ||
| 2zpq_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 1 From | 3e-06 | ||
| 2zpq_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 1 From | 4e-04 | ||
| 1h8d_H | 260 | X-Ray Structure Of The Human Alpha-Thrombin Complex | 3e-06 | ||
| 1h8d_H | 260 | X-Ray Structure Of The Human Alpha-Thrombin Complex | 3e-05 | ||
| 2zpr_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 2 From | 3e-06 | ||
| 2zpr_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 2 From | 4e-04 | ||
| 2bvr_H | 252 | Human Thrombin Complexed With Fragment-based Small | 3e-06 | ||
| 2bvr_H | 252 | Human Thrombin Complexed With Fragment-based Small | 3e-05 | ||
| 3jz1_B | 259 | Crystal Structure Of Human Thrombin Mutant N143p In | 4e-06 | ||
| 3jz1_B | 259 | Crystal Structure Of Human Thrombin Mutant N143p In | 2e-04 | ||
| 1mkw_K | 308 | The Co-Crystal Structure Of Unliganded Bovine Alpha | 4e-06 | ||
| 1zjk_A | 403 | Crystal Structure Of The Zymogen Catalytic Region O | 4e-06 | ||
| 1zjk_A | 403 | Crystal Structure Of The Zymogen Catalytic Region O | 2e-04 | ||
| 1id5_H | 256 | Crystal Structure Of Bovine Thrombin Complex With P | 4e-06 | ||
| 2tbs_A | 222 | Cold-Adaption Of Enzymes: Structural Comparison Bet | 4e-06 | ||
| 2tbs_A | 222 | Cold-Adaption Of Enzymes: Structural Comparison Bet | 5e-04 | ||
| 1bbr_K | 259 | The Structure Of Residues 7-16 Of The A Alpha Chain | 4e-06 | ||
| 1eaw_A | 241 | Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A | 5e-06 | ||
| 1eaw_A | 241 | Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A | 7e-05 | ||
| 3p8g_A | 241 | Crystal Structure Of Mt-Sp1 In Complex With Benzami | 6e-06 | ||
| 3p8g_A | 241 | Crystal Structure Of Mt-Sp1 In Complex With Benzami | 7e-05 | ||
| 2gp9_B | 259 | Crystal Structure Of The Slow Form Of Thrombin In A | 6e-06 | ||
| 2gp9_B | 259 | Crystal Structure Of The Slow Form Of Thrombin In A | 5e-04 | ||
| 1iau_A | 227 | Human Granzyme B In Complex With Ac-Iepd-Cho Length | 7e-06 | ||
| 1fq3_A | 227 | Crystal Structure Of Human Granzyme B Length = 227 | 7e-06 | ||
| 2wph_S | 235 | Factor Ixa Superactive Triple Mutant Length = 235 | 1e-05 | ||
| 2wpm_S | 235 | Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le | 1e-05 | ||
| 2wpi_S | 235 | Factor Ixa Superactive Double Mutant Length = 235 | 2e-05 | ||
| 1bbr_H | 150 | The Structure Of Residues 7-16 Of The A Alpha Chain | 2e-05 | ||
| 3plk_A | 223 | Bovine Trypsin Variant X(Tripleile227) In Complex W | 4e-05 | ||
| 3pwb_A | 223 | Bovine Trypsin Variant X(Tripleglu217ile227) In Com | 4e-05 | ||
| 3pmj_A | 223 | Bovine Trypsin Variant X(Tripleile227) In Complex W | 4e-05 | ||
| 1v2k_T | 223 | Factor Xa Specific Inhibitor In Complex With Bovine | 4e-05 | ||
| 4b2a_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 4e-05 | ||
| 4b1t_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 4e-05 | ||
| 1ekb_B | 235 | The Serine Protease Domain Of Enteropeptidase Bound | 4e-05 | ||
| 1ekb_B | 235 | The Serine Protease Domain Of Enteropeptidase Bound | 5e-04 | ||
| 3unq_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 4e-05 | ||
| 1v2n_T | 223 | Potent Factor Xa Inhibitor In Complex With Bovine T | 4e-05 | ||
| 4b2b_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 4e-05 | ||
| 1y59_T | 223 | Dianhydrosugar-Based Benzamidine, Factor Xa Specifi | 4e-05 | ||
| 4b2c_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 4e-05 | ||
| 3uqv_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 4e-05 | ||
| 3uns_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 4e-05 | ||
| 3uwi_A | 223 | Bovine Trypsin Variant X(Tripleglu217phe227) In Com | 4e-05 | ||
| 4gaw_A | 226 | Crystal Structure Of Active Human Granzyme H Length | 4e-05 | ||
| 1dlk_B | 230 | Crystal Structure Analysis Of Delta-Chymotrypsin Bo | 4e-05 | ||
| 1dlk_B | 230 | Crystal Structure Analysis Of Delta-Chymotrypsin Bo | 4e-04 | ||
| 2eek_A | 220 | Crystal Structure Of Atlantic Cod Trypsin Complexed | 5e-05 | ||
| 2cga_A | 245 | Bovine Chymotrypsinogen A. X-Ray Crystal Structure | 5e-05 | ||
| 2cga_A | 245 | Bovine Chymotrypsinogen A. X-Ray Crystal Structure | 5e-04 | ||
| 1mtn_B | 131 | Bovine Alpha-Chymotrypsin:bpti Crystallization Leng | 5e-05 | ||
| 1mtn_B | 131 | Bovine Alpha-Chymotrypsin:bpti Crystallization Leng | 4e-04 | ||
| 3veq_B | 223 | A Binary Complex Betwwen Bovine Pancreatic Trypsin | 5e-05 | ||
| 3v0x_A | 223 | Bovine Trypsin Variant X(Tripleglu217phe227) In Com | 5e-05 | ||
| 2d8w_A | 223 | Structure Of Hyper-Vil-Trypsin Length = 223 | 6e-05 | ||
| 1v2u_T | 223 | Benzamidine In Complex With Bovine Trypsin Varinat | 6e-05 | ||
| 1v2o_T | 223 | Trypsin Inhibitor In Complex With Bovine Trypsin Va | 6e-05 | ||
| 1v2q_T | 223 | Trypsin Inhibitor In Complex With Bovine Trypsin Va | 6e-05 | ||
| 2zgc_A | 240 | Crystal Structure Of Active Human Granzyme M Length | 6e-05 | ||
| 1v2j_T | 223 | Benzamidine In Complex With Bovine Trypsin Variant | 6e-05 | ||
| 1taw_A | 223 | Bovine Trypsin Complexed To Appi Length = 223 | 6e-05 | ||
| 2tld_E | 220 | Crystal Structure Of An Engineered Subtilisin Inhib | 6e-05 | ||
| 1v2s_T | 223 | Benzamidine In Complex With Bovine Trypsin Variant | 7e-05 | ||
| 5ptp_A | 223 | Structure Of Hydrolase (Serine Proteinase) Length = | 7e-05 | ||
| 1hj9_A | 223 | Atomic Resolution Structures Of Trypsin Provide Ins | 7e-05 | ||
| 1tab_E | 223 | Structure Of The Trypsin-Binding Domain Of Bowman-B | 7e-05 | ||
| 3otj_E | 223 | A Crystal Structure Of Trypsin Complexed With Bpti | 7e-05 | ||
| 1rfn_A | 235 | Human Coagulation Factor Ixa In Complex With P-Amin | 7e-05 | ||
| 3kcg_H | 235 | Crystal Structure Of The Antithrombin-Factor Ixa- P | 7e-05 | ||
| 1oph_B | 243 | Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh | 8e-05 | ||
| 1f0t_A | 243 | Bovine Trypsin Complexed With Rpr131247 Length = 24 | 8e-05 | ||
| 1g3b_A | 228 | Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba | 8e-05 | ||
| 1tgs_Z | 229 | Three-Dimensional Structure Of The Complex Between | 8e-05 | ||
| 1zzz_A | 237 | Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes | 8e-05 | ||
| 1dan_H | 254 | Complex Of Active Site Inhibited Human Blood Coagul | 8e-05 | ||
| 1dan_H | 254 | Complex Of Active Site Inhibited Human Blood Coagul | 7e-04 | ||
| 2fi4_E | 223 | Crystal Structure Of A Bpti Variant (Cys14->ser) In | 9e-05 | ||
| 2qy0_B | 242 | Active Dimeric Structure Of The Catalytic Domain Of | 9e-05 | ||
| 3bn9_B | 241 | Crystal Structure Of Mt-Sp1 In Complex With Fab Inh | 9e-05 | ||
| 3ela_H | 254 | Crystal Structure Of Active Site Inhibited Coagulat | 1e-04 | ||
| 3ela_H | 254 | Crystal Structure Of Active Site Inhibited Coagulat | 8e-04 | ||
| 1md7_A | 328 | Monomeric Structure Of The Zymogen Of Complement Pr | 1e-04 | ||
| 1md8_A | 329 | Monomeric Structure Of The Active Catalytic Domain | 1e-04 | ||
| 3tju_A | 226 | Crystal Structure Of Human Granzyme H With An Inhib | 1e-04 | ||
| 1kig_H | 241 | Bovine Factor Xa Length = 241 | 1e-04 | ||
| 4f4o_C | 347 | Structure Of The Haptoglobin-Haemoglobin Complex Le | 1e-04 | ||
| 4f4o_C | 347 | Structure Of The Haptoglobin-Haemoglobin Complex Le | 2e-04 | ||
| 1ntp_A | 223 | Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU | 2e-04 | ||
| 2zgj_A | 240 | Crystal Structure Of D86n-gzmm Complexed With Its O | 2e-04 | ||
| 4an7_A | 231 | Kunitz Type Trypsin Inhibitor Complex With Porcine | 2e-04 | ||
| 1tfx_A | 223 | Complex Of The Second Kunitz Domain Of Tissue Facto | 2e-04 | ||
| 3myw_A | 223 | The Bowman-Birk Type Inhibitor From Mung Bean In Te | 2e-04 | ||
| 2a31_A | 223 | Trypsin In Complex With Borate Length = 223 | 2e-04 | ||
| 1gpz_A | 399 | The Crystal Structure Of The Zymogen Catalytic Doma | 2e-04 | ||
| 1a0j_A | 223 | Crystal Structure Of A Non-Psychrophilic Trypsin Fr | 2e-04 | ||
| 1mct_A | 223 | The Refined 1.6 Angstroms Resolution Crystal Struct | 3e-04 | ||
| 2f91_A | 237 | 1.2a Resolution Structure Of A Crayfish Trypsin Com | 3e-04 | ||
| 3dfj_A | 263 | Crystal Structure Of Human Prostasin Length = 263 | 3e-04 | ||
| 1h9h_E | 231 | Complex Of Eeti-Ii With Porcine Trypsin Length = 23 | 3e-04 | ||
| 1elv_A | 333 | Crystal Structure Of The Catalytic Domain Of Human | 3e-04 | ||
| 1an1_E | 223 | Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len | 3e-04 | ||
| 2y5f_A | 234 | Factor Xa - Cation Inhibitor Complex Length = 234 | 3e-04 | ||
| 2bok_A | 241 | Factor Xa- Cation Length = 241 | 3e-04 | ||
| 3gyl_B | 261 | Structure Of Prostasin At 1.3 Angstroms Resolution | 4e-04 | ||
| 3e0p_B | 271 | The X-Ray Structure Of Human Prostasin In Complex W | 4e-04 | ||
| 3g01_A | 227 | Structure Of Grc Mutant E192rE193G Length = 227 | 4e-04 | ||
| 2bq6_B | 249 | Crystal Structure Of Factor Xa In Complex With 21 L | 4e-04 | ||
| 3fzz_A | 227 | Structure Of Grc Length = 227 | 4e-04 | ||
| 1xka_C | 235 | Factor Xa Complexed With A Synthetic Inhibitor Fx-2 | 4e-04 | ||
| 2ra3_A | 224 | Human Cationic Trypsin Complexed With Bovine Pancre | 5e-04 | ||
| 1hcg_A | 241 | Structure Of Human Des(1-45) Factor Xa At 2.2 Angst | 5e-04 | ||
| 1ezq_A | 254 | Crystal Structure Of Human Coagulation Factor Xa Co | 5e-04 | ||
| 3ens_B | 238 | Crystal Structure Of Human Fxa In Complex With Meth | 5e-04 | ||
| 1fjs_A | 234 | Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 | 5e-04 | ||
| 1c5m_D | 255 | Structural Basis For Selectivity Of A Small Molecul | 5e-04 | ||
| 2gd4_H | 241 | Crystal Structure Of The Antithrombin-S195a Factor | 5e-04 | ||
| 1mq5_A | 233 | Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch | 5e-04 | ||
| 1fax_A | 254 | Coagulation Factor Xa Inhibitor Complex Length = 25 | 5e-04 | ||
| 1aks_A | 125 | Crystal Structure Of The First Active Autolysate Fo | 5e-04 | ||
| 1ept_B | 82 | Refined 1.8 Angstroms Resolution Crystal Structure | 5e-04 | ||
| 2jet_B | 128 | Crystal Structure Of A Trypsin-Like Mutant (S189d, | 5e-04 | ||
| 1fy3_A | 225 | [g175q]hbp, A Mutant Of Human Heparin Binding Prote | 6e-04 | ||
| 1a7s_A | 225 | Atomic Resolution Structure Of Hbp Length = 225 | 6e-04 | ||
| 1fy1_A | 225 | [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P | 6e-04 | ||
| 1hyl_A | 230 | The 1.8 A Structure Of Collagenase From Hypoderma L | 7e-04 | ||
| 1fiw_A | 290 | Three-Dimensional Structure Of Beta-Acrosin From Ra | 7e-04 | ||
| 3qk1_A | 229 | Crystal Structure Of Enterokinase-Like Trypsin Vari | 7e-04 | ||
| 1m9u_A | 241 | Crystal Structure Of Earthworm Fibrinolytic Enzyme | 7e-04 | ||
| 1euf_A | 227 | Bovine Duodenase(New Serine Protease), Crystal Stru | 8e-04 | ||
| 2qxg_A | 224 | Crystal Structure Of Human Kallikrein 7 In Complex | 9e-04 |
| >pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 | Back alignment and structure |
|
| >pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 | Back alignment and structure |
| >pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 | Back alignment and structure |
| >pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 | Back alignment and structure |
| >pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 | Back alignment and structure |
| >pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 | Back alignment and structure |
| >pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 | Back alignment and structure |
| >pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 | Back alignment and structure |
| >pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 | Back alignment and structure |
| >pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 | Back alignment and structure |
| >pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 | Back alignment and structure |
| >pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 | Back alignment and structure |
| >pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 | Back alignment and structure |
| >pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 | Back alignment and structure |
| >pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 | Back alignment and structure |
| >pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 | Back alignment and structure |
| >pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 | Back alignment and structure |
| >pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 | Back alignment and structure |
| >pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 | Back alignment and structure |
| >pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 | Back alignment and structure |
| >pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 | Back alignment and structure |
| >pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 | Back alignment and structure |
| >pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 | Back alignment and structure |
| >pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 | Back alignment and structure |
| >pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 | Back alignment and structure |
| >pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 | Back alignment and structure |
| >pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 | Back alignment and structure |
| >pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 | Back alignment and structure |
| >pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 | Back alignment and structure |
| >pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 | Back alignment and structure |
| >pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 | Back alignment and structure |
| >pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 | Back alignment and structure |
| >pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 | Back alignment and structure |
| >pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 | Back alignment and structure |
| >pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 | Back alignment and structure |
| >pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 | Back alignment and structure |
| >pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 | Back alignment and structure |
| >pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 | Back alignment and structure |
| >pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 | Back alignment and structure |
| >pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 | Back alignment and structure |
| >pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 | Back alignment and structure |
| >pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 | Back alignment and structure |
| >pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 | Back alignment and structure |
| >pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 | Back alignment and structure |
| >pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 | Back alignment and structure |
| >pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 | Back alignment and structure |
| >pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 | Back alignment and structure |
| >pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 | Back alignment and structure |
| >pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 | Back alignment and structure |
| >pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 | Back alignment and structure |
| >pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 | Back alignment and structure |
| >pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 | Back alignment and structure |
| >pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 | Back alignment and structure |
| >pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 | Back alignment and structure |
| >pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 | Back alignment and structure |
| >pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 | Back alignment and structure |
| >pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 | Back alignment and structure |
| >pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 | Back alignment and structure |
| >pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 | Back alignment and structure |
| >pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 | Back alignment and structure |
| >pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 | Back alignment and structure |
| >pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 | Back alignment and structure |
| >pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 | Back alignment and structure |
| >pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 | Back alignment and structure |
| >pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 | Back alignment and structure |
| >pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 | Back alignment and structure |
| >pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 | Back alignment and structure |
| >pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 | Back alignment and structure |
| >pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 | Back alignment and structure |
| >pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 | Back alignment and structure |
| >pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 | Back alignment and structure |
| >pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 | Back alignment and structure |
| >pdb|2HNT|E Chain E, Crystallographic Structure Of Human Gamma-Thrombin Length = 81 | Back alignment and structure |
| >pdb|2HNT|E Chain E, Crystallographic Structure Of Human Gamma-Thrombin Length = 81 | Back alignment and structure |
| >pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 | Back alignment and structure |
| >pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 | Back alignment and structure |
| >pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 | Back alignment and structure |
| >pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 | Back alignment and structure |
| >pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 | Back alignment and structure |
| >pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 | Back alignment and structure |
| >pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 | Back alignment and structure |
| >pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 | Back alignment and structure |
| >pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 | Back alignment and structure |
| >pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 | Back alignment and structure |
| >pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 | Back alignment and structure |
| >pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 | Back alignment and structure |
| >pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 | Back alignment and structure |
| >pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 | Back alignment and structure |
| >pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 | Back alignment and structure |
| >pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 | Back alignment and structure |
| >pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 | Back alignment and structure |
| >pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 | Back alignment and structure |
| >pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 | Back alignment and structure |
| >pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 | Back alignment and structure |
| >pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 | Back alignment and structure |
| >pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | Back alignment and structure |
| >pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | Back alignment and structure |
| >pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 | Back alignment and structure |
| >pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 | Back alignment and structure |
| >pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 | Back alignment and structure |
| >pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 | Back alignment and structure |
| >pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 | Back alignment and structure |
| >pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 | Back alignment and structure |
| >pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 | Back alignment and structure |
| >pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 | Back alignment and structure |
| >pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 | Back alignment and structure |
| >pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 | Back alignment and structure |
| >pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 | Back alignment and structure |
| >pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 | Back alignment and structure |
| >pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 | Back alignment and structure |
| >pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 | Back alignment and structure |
| >pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 | Back alignment and structure |
| >pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 | Back alignment and structure |
| >pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 | Back alignment and structure |
| >pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 | Back alignment and structure |
| >pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 | Back alignment and structure |
| >pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 | Back alignment and structure |
| >pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 | Back alignment and structure |
| >pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 | Back alignment and structure |
| >pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 | Back alignment and structure |
| >pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 | Back alignment and structure |
| >pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 | Back alignment and structure |
| >pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 | Back alignment and structure |
| >pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 | Back alignment and structure |
| >pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 | Back alignment and structure |
| >pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 | Back alignment and structure |
| >pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 | Back alignment and structure |
| >pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 | Back alignment and structure |
| >pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 | Back alignment and structure |
| >pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 | Back alignment and structure |
| >pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 | Back alignment and structure |
| >pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 | Back alignment and structure |
| >pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 | Back alignment and structure |
| >pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 | Back alignment and structure |
| >pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 | Back alignment and structure |
| >pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 | Back alignment and structure |
| >pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 | Back alignment and structure |
| >pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 | Back alignment and structure |
| >pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 | Back alignment and structure |
| >pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 | Back alignment and structure |
| >pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 | Back alignment and structure |
| >pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 | Back alignment and structure |
| >pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 | Back alignment and structure |
| >pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 | Back alignment and structure |
| >pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 | Back alignment and structure |
| >pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 | Back alignment and structure |
| >pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 | Back alignment and structure |
| >pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 | Back alignment and structure |
| >pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 | Back alignment and structure |
| >pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 | Back alignment and structure |
| >pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 | Back alignment and structure |
| >pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 | Back alignment and structure |
| >pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 | Back alignment and structure |
| >pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 | Back alignment and structure |
| >pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 | Back alignment and structure |
| >pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 | Back alignment and structure |
| >pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 | Back alignment and structure |
| >pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 | Back alignment and structure |
| >pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 | Back alignment and structure |
| >pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 | Back alignment and structure |
| >pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 | Back alignment and structure |
| >pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 | Back alignment and structure |
| >pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 | Back alignment and structure |
| >pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 | Back alignment and structure |
| >pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 | Back alignment and structure |
| >pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 | Back alignment and structure |
| >pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 | Back alignment and structure |
| >pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 | Back alignment and structure |
| >pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 | Back alignment and structure |
| >pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 | Back alignment and structure |
| >pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 | Back alignment and structure |
| >pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 | Back alignment and structure |
| >pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 | Back alignment and structure |
| >pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 | Back alignment and structure |
| >pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 | Back alignment and structure |
| >pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 | Back alignment and structure |
| >pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 | Back alignment and structure |
| >pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 | Back alignment and structure |
| >pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 | Back alignment and structure |
| >pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 | Back alignment and structure |
| >pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 | Back alignment and structure |
| >pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 | Back alignment and structure |
| >pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 | Back alignment and structure |
| >pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 | Back alignment and structure |
| >pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 | Back alignment and structure |
| >pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 | Back alignment and structure |
| >pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 | Back alignment and structure |
| >pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 | Back alignment and structure |
| >pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 | Back alignment and structure |
| >pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 | Back alignment and structure |
| >pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 | Back alignment and structure |
| >pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 | Back alignment and structure |
| >pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 | Back alignment and structure |
| >pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 | Back alignment and structure |
| >pdb|1EPT|B Chain B, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 82 | Back alignment and structure |
| >pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 | Back alignment and structure |
| >pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 | Back alignment and structure |
| >pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 | Back alignment and structure |
| >pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 | Back alignment and structure |
| >pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 | Back alignment and structure |
| >pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 | Back alignment and structure |
| >pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 | Back alignment and structure |
| >pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 | Back alignment and structure |
| >pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 | Back alignment and structure |
| >pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 132 | |||
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 3e-21 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 1e-15 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 7e-21 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 3e-15 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 2e-20 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 2e-14 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 5e-20 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 3e-15 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 7e-19 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 6e-12 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 2e-18 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 9e-13 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 2e-18 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 7e-13 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 3e-18 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 2e-13 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 4e-18 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 3e-11 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 7e-18 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 2e-11 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 7e-18 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 2e-12 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 1e-17 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 2e-11 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 1e-17 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 1e-12 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 1e-17 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 3e-11 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 1e-17 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 2e-11 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 1e-17 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 2e-12 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 2e-17 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 1e-12 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 2e-17 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 2e-12 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 2e-17 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 3e-12 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 2e-17 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 5e-12 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 2e-17 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 3e-12 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 2e-17 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 9e-12 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 2e-17 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 7e-13 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 3e-17 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 1e-12 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 4e-17 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 2e-11 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 4e-17 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 6e-12 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 5e-17 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 1e-10 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 5e-17 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 1e-12 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 6e-17 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 2e-11 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 6e-17 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 1e-11 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 7e-17 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 7e-11 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 7e-17 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 2e-12 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 7e-17 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 1e-10 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 8e-17 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 1e-12 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 8e-17 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 4e-12 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 1e-16 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 9e-13 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 1e-16 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 1e-12 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 1e-16 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 6e-10 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 2e-16 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 8e-11 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 2e-16 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 8e-11 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 2e-16 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 2e-11 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 2e-16 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 2e-11 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 2e-16 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 3e-10 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 2e-16 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 1e-10 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 2e-16 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 2e-10 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 3e-16 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 5e-13 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 4e-16 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 1e-11 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 6e-16 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 1e-10 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 8e-16 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 2e-10 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 9e-16 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 1e-11 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 1e-15 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 5e-10 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 1e-15 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 2e-09 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 1e-15 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 4e-09 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 1e-15 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 2e-11 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 2e-15 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 6e-09 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 2e-15 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 1e-11 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 2e-15 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 2e-10 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 2e-15 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 2e-12 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 2e-15 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 2e-10 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 2e-15 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 5e-13 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 3e-15 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 1e-11 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 5e-15 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 1e-08 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 5e-15 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 1e-10 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 5e-15 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 2e-08 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 6e-15 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 3e-11 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 6e-15 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 9e-09 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 6e-15 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 5e-10 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 6e-15 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 1e-08 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 8e-15 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 8e-11 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 8e-15 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 2e-08 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 8e-15 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 2e-10 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 8e-15 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 1e-10 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 1e-14 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 3e-11 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 2e-14 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 1e-10 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 2e-14 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 8e-11 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 2e-14 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 3e-10 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 3e-14 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 6e-10 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 3e-14 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 1e-09 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 5e-14 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 2e-09 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 5e-14 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 2e-09 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 1e-13 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 3e-10 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 2e-13 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 8e-10 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 3e-13 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 5e-11 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 5e-13 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 4e-11 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 6e-13 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 9e-09 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 2e-12 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 5e-09 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 2e-12 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 4e-11 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 4e-12 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 3e-10 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 6e-12 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 7e-12 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 1e-11 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 4e-08 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 2e-11 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 2e-08 |
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 | Back alignment and structure |
|---|
Score = 84.2 bits (209), Expect = 3e-21
Identities = 19/65 (29%), Positives = 31/65 (47%)
Query: 10 FVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASS 69
FV+ Y P+ NDV++IK + F ++ P+C PD V + + +GWG
Sbjct: 78 FVNENYDPATLENDVSVIKTAVAITFDINVGPICAPDPANDYVYRKSQCSGWGTINSGGV 137
Query: 70 LSSAI 74
A+
Sbjct: 138 CCPAV 142
|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.84 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.84 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.84 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.84 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.84 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.83 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.83 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.83 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.83 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.83 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.83 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.83 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.83 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.83 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.83 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.83 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.83 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.82 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.82 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.82 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.82 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.82 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.82 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.82 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.82 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.82 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.81 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.81 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.81 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.81 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.81 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.81 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.81 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.81 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.81 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.81 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.8 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 99.8 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.8 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 99.8 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.8 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.8 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.79 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.79 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.79 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.79 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.79 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.79 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 99.78 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.78 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.78 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.78 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.78 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 99.77 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.77 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.77 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.77 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.77 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.77 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.77 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.77 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.76 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.76 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.76 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.76 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.76 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 99.75 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.75 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.75 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.75 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.75 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.74 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.74 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 99.74 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.74 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.74 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.74 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 99.73 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.73 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 99.73 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.73 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.72 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 99.71 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.7 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.68 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.67 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.65 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.65 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.61 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.6 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.55 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 99.48 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 99.47 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 99.43 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.4 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.39 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.17 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 99.05 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.93 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.86 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.8 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.8 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 98.78 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.7 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.7 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 98.68 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 98.67 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 98.66 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 98.65 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 98.65 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 98.65 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 98.64 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 98.64 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 98.63 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 98.63 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 98.62 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 98.62 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 98.62 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 98.62 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 98.62 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 98.61 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 98.61 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 98.6 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 98.59 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 98.59 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 98.59 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 98.59 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 98.58 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.58 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 98.57 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 98.57 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 98.57 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 98.56 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 98.56 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 98.56 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 98.56 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 98.55 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 98.55 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 98.55 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 98.54 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 98.52 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 98.52 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 98.52 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 98.51 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 98.51 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 98.5 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 98.5 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 98.5 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 98.5 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 98.5 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 98.5 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 98.49 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 98.49 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 98.48 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 98.48 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 98.48 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 98.48 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 98.46 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 98.44 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 98.44 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 98.44 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 98.43 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 98.43 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 98.42 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 98.42 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 98.41 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 98.41 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 98.41 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 98.4 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 98.4 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 98.39 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 98.39 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 98.38 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 98.38 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 98.38 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 98.38 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 98.37 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 98.36 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 98.34 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 98.33 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 98.31 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 98.29 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 98.28 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 98.27 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 98.26 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 98.26 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 98.25 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 98.22 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 98.16 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.15 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.1 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 98.07 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 98.0 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 97.99 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 97.81 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 97.75 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 97.57 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 97.57 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 97.52 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 97.37 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 97.33 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 97.24 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 97.24 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 97.22 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 97.15 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 97.13 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 97.12 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 97.03 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 97.02 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 96.98 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 96.93 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 96.89 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 96.86 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 96.74 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 96.62 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 96.61 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 96.52 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 96.45 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 95.09 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 94.17 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 94.17 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 93.72 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 93.61 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 92.95 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 92.78 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 92.63 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 92.48 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 91.2 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 91.08 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 90.92 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 89.9 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 89.65 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 89.4 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 85.67 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 85.07 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 84.3 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 83.13 |
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
Probab=99.84 E-value=4.1e-21 Score=120.91 Aligned_cols=122 Identities=20% Similarity=0.427 Sum_probs=93.1
Q ss_pred eEEeeeEEEeCCCCCCCCCCCceEEEEeCCCeeeCCCeeeeeecCCCCcccCCcEEEeccCccccCCCcccccceeee--
Q psy15292 2 FKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSLSSAIPTYVS-- 79 (132)
Q Consensus 2 ~~~~v~~~~~h~~y~~~~~~~diall~l~~~~~~~~~~~~~cl~~~~~~~~g~~~~~~GwG~~~~~~~~~~~~l~~~~-- 79 (132)
+.+.|.++++||+|+.....+|||||+|++++.++++++|+|||..... .+..++++|||.+.......+..|+++.
T Consensus 63 ~~~~v~~i~~Hp~y~~~~~~~DIALl~L~~~~~~~~~v~picL~~~~~~-~~~~~~v~GwG~~~~~~~~~~~~L~~~~~~ 141 (223)
T 3mfj_A 63 QFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCAS-AGTQCLISGWGNTKSSGTSYPDVLKCLKAP 141 (223)
T ss_dssp EEEEEEEEEECTTCCTTTCTTCCEEEEESSCCCCBTTBCCCBCCSSCCC-TTCEEEEEESSCCCSSSCCCCSSCEEEEEE
T ss_pred EEEEeeEEEECCCCCCCCCCCCEEEEEeCCCcccCCcEeeeECCCCCCC-CCCEEEEEeeeccCCCCCcccchheEEEEE
Confidence 4678999999999999889999999999999999999999999976653 7889999999988644333456677655
Q ss_pred -ccCCeEEEEeccce----eec---cCeeeeecCCCCCCC--CCceEEEEeeccc
Q psy15292 80 -ISNDVALIKIDKDV----VFK---QHIIPVCLPDQTVKL--VGKSATVAGWGRT 124 (132)
Q Consensus 80 -~~~d~c~~~~~~~~----~~~---~~v~~icl~~~~~~~--~g~~~~v~gwg~~ 124 (132)
++++.|...+...+ -.. ......|.++++.++ .+....|..||..
T Consensus 142 ~~~~~~C~~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGgPL~~~~~l~GI~S~g~~ 196 (223)
T 3mfj_A 142 ILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSG 196 (223)
T ss_dssp BCCHHHHHHHSTTTCCTTEEEESCTTSSCBCCTTCTTCEEEETTEEEEEEEECSS
T ss_pred EeCHHHhhhhhcCcCCCCEEEccCCCCCCCcCCCCcccceEECCEEEEEEEECCC
Confidence 67777765442211 111 122347888888887 7889999999953
|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 132 | ||||
| d1hj8a_ | 222 | b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon | 2e-05 | |
| d1hj8a_ | 222 | b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon | 0.002 | |
| d2f91a1 | 237 | b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c | 5e-05 | |
| d1sgfa_ | 228 | b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus | 2e-04 | |
| d1j16a_ | 223 | b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu | 3e-04 | |
| d1arba_ | 263 | b.47.1.1 (A:) Achromobacter protease {Achromobacte | 5e-04 |
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Eukaryotic proteases domain: Trypsin(ogen) species: North atlantic salmon (Salmo salar) [TaxId: 8030]
Score = 40.0 bits (92), Expect = 2e-05
Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
Query: 1 MFKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAG 60
+++ + HP YS + ND+ LIK+ K ++ PV LP G TV+G
Sbjct: 62 EQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAP-AGTMCTVSG 120
Query: 61 WGRTRH 66
WG T
Sbjct: 121 WGNTMS 126
|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.64 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 99.6 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 99.59 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 99.58 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 99.58 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 99.55 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 99.54 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 99.54 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 99.53 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 99.53 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 99.53 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.51 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 99.51 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.51 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.51 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 99.51 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 99.49 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 99.49 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.47 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 99.46 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 99.45 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 99.45 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.43 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 99.43 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.43 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 99.42 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.41 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 99.4 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 99.38 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 99.36 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 99.35 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 99.35 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 99.34 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 99.34 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 99.29 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 99.26 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 99.21 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 99.19 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 99.16 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 99.1 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 99.1 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.97 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.95 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.86 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.86 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.78 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 98.07 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 98.01 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 97.81 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 97.81 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 97.79 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 97.75 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 97.75 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 97.74 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 97.7 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 97.7 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 97.66 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 97.61 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 97.6 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 97.6 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 97.57 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 97.55 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 97.54 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 97.54 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 97.53 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 97.53 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 97.5 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 97.48 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 97.46 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 97.45 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 97.44 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 97.43 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 97.38 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 97.37 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 97.36 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 97.28 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 97.23 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 97.16 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 97.14 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 97.13 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 97.09 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 97.03 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 97.03 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 96.99 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 96.99 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 96.94 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 96.89 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 96.88 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 96.88 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 96.84 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 96.73 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 96.41 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 96.27 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 96.18 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 95.98 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 95.76 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 95.52 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 95.33 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 94.76 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 94.5 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 92.89 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 91.83 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 87.89 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 81.18 |
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Eukaryotic proteases domain: Kallikrein 6 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66 E-value=1.7e-16 Score=97.90 Aligned_cols=123 Identities=15% Similarity=0.281 Sum_probs=90.3
Q ss_pred eEEeeeEEEeCCCCCCCCCCCceEEEEeCCCeeeCCCeeeeeecCCCCcccCCcEEEeccCccccCCCcccccceeee--
Q psy15292 2 FKLNTRQSFVHPQYSPSDFRNDVALIKIDKDVVFKQHIIPVCLPDQTVKLVGKSATVAGWGRTRHASSLSSAIPTYVS-- 79 (132)
Q Consensus 2 ~~~~v~~~~~h~~y~~~~~~~diall~l~~~~~~~~~~~~~cl~~~~~~~~g~~~~~~GwG~~~~~~~~~~~~l~~~~-- 79 (132)
+...+.++++||+|+.....+|||||+|..++.++++++|+||+..... .+..+.++|||....... ...++...
T Consensus 64 ~~~~~~~~~~~p~y~~~~~~~diAll~l~~~~~~~~~v~pi~l~~~~~~-~~~~~~~~Gwg~~~~~~~--~~~l~~~~~~ 140 (221)
T d1lo6a_ 64 EQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSA-NTTSCHILGWGKTADGDF--PDTIQCAYIH 140 (221)
T ss_dssp EEEEEEEEEECTTCCTTTCTTCCEEEEESSCCCCBTTBCCCCBCCCTTC-CCCEEEEEESSCCTTSSC--CSBCEEEEEE
T ss_pred eeeeccccccCCCcccccccceeEEeecccccceeeeEEeccccccCCc-ccceEEEEecccccCCCC--CccceEEEEE
Confidence 3567889999999999999999999999999999999999999976654 778899999998765432 33444433
Q ss_pred -ccCCeEEEEeccceee-------ccCeeeeecCCCCCCC--CCceEEEEeecccCcC
Q psy15292 80 -ISNDVALIKIDKDVVF-------KQHIIPVCLPDQTVKL--VGKSATVAGWGRTRHA 127 (132)
Q Consensus 80 -~~~d~c~~~~~~~~~~-------~~~v~~icl~~~~~~~--~g~~~~v~gwg~~~~~ 127 (132)
++++.|...+.....- ...-...|.++.+.++ .+...+|..||...+.
T Consensus 141 ~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~~c~gd~G~Pl~~~~~l~Gi~S~g~~~c~ 198 (221)
T d1lo6a_ 141 LVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCG 198 (221)
T ss_dssp EECHHHHHHHSTTTCCTTEEEEECTTTCCBCCTTTTTCEEEETTEEEEEEEECCSSCC
T ss_pred EecHHHHHHHcCCCccCCceeeeccccCCCCccCCCCCcEEECCEEEEEEEEccCCCC
Confidence 6677776554432211 1112236777887776 6778889999987544
|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|