Diaphorina citri psyllid: psy15304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MRGVTSEAMVMCASTPDKVEILAPPSAAKPGDLIQVEGYTRNPDPVLNPKKKIFETVAPDLKTNDSNQATYKGKVWTVENVEGFVTSQSLANVNIK
ccccccccEEEEEEccccEEECccccccccccEEECcccccccccccccccHHHHHHccccEEcccCEEEEccEEEEEEccccEEEEccccccccc
MRGVTSEAMVMCASTPDKVEILAPPSAAKPGDLIQVE***************IFETVAPDLKTNDSNQATYKGKVWTVENVEGFVTSQSLANVNI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGVTSEAMVMCASTPDKVEILAPPSAAKPGDLIQVEGYTRNPDPVLNPKKKIFETVAPDLKTNDSNQATYKGKVWTVENVEGFVTSQSLANVNIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7.confidentP31230
Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion.confidentO54873
Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7.confidentQ12904

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017101 [CC]aminoacyl-tRNA synthetase multienzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0048514 [BP]blood vessel morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005125 [MF]cytokine activityprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0006954 [BP]inflammatory responseprobableGO:0006952, GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0043498 [MF]cell surface bindingprobable
GO:0051607 [BP]defense response to virusprobableGO:0002376, GO:0009607, GO:0009615, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0002252, GO:0051707, GO:0051704
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0000049 [MF]tRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0050900 [BP]leukocyte migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0016525 [BP]negative regulation of angiogenesisprobableGO:0051093, GO:0022603, GO:0050793, GO:0045765, GO:0008150, GO:1901342, GO:0065007, GO:2000026, GO:0051239, GO:0048519, GO:0050789
GO:0001937 [BP]negative regulation of endothelial cell proliferationprobableGO:0042127, GO:0008285, GO:0050678, GO:0050680, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523, GO:0001936
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FL0, chain A
Confidence level:very confident
Coverage over the Query: 1-96
View the alignment between query and template
View the model in PyMOL