Diaphorina citri psyllid: psy15307

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50

MLASQVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL

ccccccccEEEEEEEccccccEEEEEEccccEEEEcccccccccccccHHHHHccccccEECcccccHHHHccccccccccccccccccccccEEEEECccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHcccccccccccCEEEcccEEEEEEccccEEEEEEcccEEEEEEccccccccccccccEEEEEEEEEEEEcccEEEEEEEEccccEEEEEccccccccccEEEEcccccccccccccccccccHHHHHHHHHcEEEcccccccccccHHHHHHHHHHccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccCEEEEEcccccccccccccccccEEEEEEEccccccccccccccccccccEEEEECcccccccccccEEEEcccEEEccccccccc

******KGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGW************************************VKAQIICES*******************ILNNMGVMEYNTHSKVLSISLR********************DEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal transducer and activator of transcription 5B	Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.	confident	P51692
Signal transducer and activator of transcription 5B	Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.	confident	P52632
Signal transducer and activator of transcription 5B	Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.	confident	Q9TUZ0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019530 [BP]	taurine metabolic process	probable	GO:1901564, GO:0009987, GO:0044237, GO:0071704, GO:0006807, GO:0006790, GO:0008152, GO:0008150
GO:0006573 [BP]	valine metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:1901605, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0044237, GO:0009081
GO:0000979 [MF]	RNA polymerase II core promoter sequence-specific DNA binding	probable	GO:0044212, GO:0003676, GO:0043565, GO:0001067, GO:0000975, GO:0001012, GO:0000976, GO:0000977, GO:0001047, GO:0001046, GO:0003674, GO:0097159, GO:0003677, GO:1901363, GO:0005488
GO:0045621 [BP]	positive regulation of lymphocyte differentiation	probable	GO:0050865, GO:0050867, GO:0050789, GO:0051249, GO:0002684, GO:0065007, GO:0048518, GO:0002682, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0001889 [BP]	liver development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018108 [BP]	peptidyl-tyrosine phosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0006105 [BP]	succinate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0032355 [BP]	response to estradiol stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0044765 [BP]	single-organism transport	probable	GO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0040014 [BP]	regulation of multicellular organism growth	probable	GO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0033036 [BP]	macromolecule localization	probable	GO:0008150, GO:0051179
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006366 [BP]	transcription from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0007548 [BP]	sex differentiation	probable	GO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0006107 [BP]	oxaloacetate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006101 [BP]	citrate metabolic process	probable	GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0006103 [BP]	2-oxoglutarate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006631 [BP]	fatty acid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0048609 [BP]	multicellular organismal reproductive process	probable	GO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0019221 [BP]	cytokine-mediated signaling pathway	probable	GO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0048583 [BP]	regulation of response to stimulus	probable	GO:0008150, GO:0065007, GO:0050789
GO:0006600 [BP]	creatine metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:1901605
GO:0060397 [BP]	JAK-STAT cascade involved in growth hormone signaling pathway	probable	GO:0042221, GO:0070887, GO:0050896, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0035556, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071378, GO:1901698, GO:0071417, GO:0007259, GO:0071310, GO:0065007, GO:0071495, GO:1901701, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0010243, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:0044700, GO:0007243, GO:0009725, GO:0060396, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0060416
GO:0006549 [BP]	isoleucine metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:1901605, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0044237, GO:0009081
GO:0006953 [BP]	acute-phase response	probable	GO:0050896, GO:0009611, GO:0006952, GO:0006950, GO:0008150, GO:0006954, GO:0002526
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0071222 [BP]	cellular response to lipopolysaccharide	probable	GO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150
GO:0001077 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription	probable	GO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0000255 [BP]	allantoin metabolic process	probable	GO:1901564, GO:0043603, GO:0009987, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0046449 [BP]	creatinine metabolic process	probable	GO:0044710, GO:1901564, GO:0043603, GO:0009987, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0046483, GO:1901360, GO:0072338
GO:0048872 [BP]	homeostasis of number of cells	probable	GO:0042592, GO:0008150, GO:0065008, GO:0065007
GO:0045637 [BP]	regulation of myeloid cell differentiation	probable	GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0002682, GO:0050789
GO:0060056 [BP]	mammary gland involution	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0048771, GO:0007275, GO:0044767, GO:0060443, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0030879, GO:0044699
GO:0045596 [BP]	negative regulation of cell differentiation	probable	GO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030098 [BP]	lymphocyte differentiation	probable	GO:0030154, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0008150
GO:0004871 [MF]	signal transducer activity	probable	GO:0060089, GO:0003674

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y1U, chain A
Confidence level:very confident
Coverage over the Query: 135-194,205-419
View the alignment between query and template
View the model in PyMOL

Template: 1Y1U, chain A
Confidence level:very confident
Coverage over the Query: 1-86
View the alignment between query and template
View the model in PyMOL

Template: 1ORU, chain A
Confidence level:probable
Coverage over the Query: 435-499
View the alignment between query and template
View the model in PyMOL