Psyllid ID: psy15307

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MLASQVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
ccccccccEEEEEEEccccccEEEEEEccccEEEEcccccccccccccHHHHHccccccEEEcccccHHHHccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHccccccccccEEEEcccEEEEEEccccEEEEEEcccEEEEEEccccccccccccccEEEEEEEEEEEEcccEEEEEEEEccccEEEEEccccccccccEEEEcccccccccccccccccccHHHHHHHHHcEEEcccccccccccHHHHHHHHHHccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccEEEEEEcccccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEcccccccccccEEEEcccEEEccccccccc
ccccccccEEEEEEEcccccEEEEEEEccccEEEEEccccHHHcccccHHHHHHccccHHEccccccHHHHHHccccccccccccccccccccEEEEEcHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEccHHHHccccccccccccccEccccEEEEEcccccEEEEEEEccEEEEEEccccccccccccHHEEEEEEEEEEEEccccEEEEEEEccccEEEEEEcccccccHHHHEHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccEEHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEcccccHHHcccccHHHHHHHccccccccccccccccccccccHHHccccccccccccccEEEEcccEEEccccccccc
mlasqvkgtfllrfsdselggitiawkgdntevfmlqpftskdfqiRNLADrisdlphlvylypdkpkdqafskyytpfqdsqpmgtngyvkpvlvthvpgwgspnnngmggmnsypstpqnmfhphsppdhtrdtaSVKAQIICESQANALLknekigksdasgeILNNMGVMEYNTHSKVLSISLRNMQLKKikrrpekrgtesvmdeKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVhgnqepnahatitwdnafaepgrspfvvpdkrpwKMIADVLMMKFEsatgrtldaeNLNFLAEKAFRQATDIKMAECADYSNMLLNWSqfckeplpdrsftFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFllrfsdselggitiawkggpekrgtvsvmdEKFSLYFSSTFSIGGGELVFQLFISMNtsrigedieplllvptprnivvdgpppyaedtwdwvrFNSDvitrqvkpctll
mlasqvkgtfllrfsdselgGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANallknekigkSDASGEILNNMGVMEYNTHSKVLSISLRNMqlkkikrrpekrgtesvmdEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITiawkggpekrgTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVItrqvkpctll
MLASQVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVpgwgspnnngmggmnsYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
*******GTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGW****************************************IICE********************ILNNMGVMEYNTHSKVLSISL**********************EKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVK*****
******KGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFS********************VLVTHV***************************************VKAQIICES*********************NNMGVMEYNTHSKVLSISLR********************DEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQ**********DY*NMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
MLASQVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKI***********VMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
****QVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLASQVKGTFLLRFSDSELGGITIAWKGDNTEVFMLQPFTSKDFQIRNLADRISDLPHLVYLYPDKPKDQAFSKYYTPFQDSQPMGTNGYVKPVLVTHVPGWGSPNNNGMGGMNSYPSTPQNMFHPHSPPDHTRDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMDEKFSLYFSSTFSIGGGELVFQLFISMNTSRIGEDIEPLLLVPTPRNIVVDGPPPYAEDTWDWVRFNSDVITRQVKPCTLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query499 2.2.26 [Sep-21-2011]
P42232786 Signal transducer and act yes N/A 0.539 0.342 0.563 3e-81
P51692787 Signal transducer and act yes N/A 0.539 0.341 0.559 4e-81
Q9TUZ0787 Signal transducer and act yes N/A 0.539 0.341 0.559 4e-81
Q9TUM3787 Signal transducer and act yes N/A 0.539 0.341 0.559 4e-81
P52632786 Signal transducer and act yes N/A 0.539 0.342 0.555 1e-80
Q9TUZ1799 Signal transducer and act no N/A 0.525 0.327 0.559 4e-78
Q62771793 Signal transducer and act no N/A 0.527 0.331 0.557 5e-78
P42229794 Signal transducer and act no N/A 0.537 0.337 0.548 7e-78
P42230793 Signal transducer and act no N/A 0.527 0.331 0.557 7e-78
P42231794 Signal transducer and act N/A N/A 0.527 0.331 0.553 1e-77
>sp|P42232|STA5B_MOUSE Signal transducer and activator of transcription 5B OS=Mus musculus GN=Stat5b PE=1 SV=1 Back     alignment and function desciption
 Score =  303 bits (775), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 197/277 (71%), Gaps = 8/277 (2%)

Query: 138 SVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKR 197
            VKA II E QA +LLKNE   ++D SGEILNN  VMEY+  +  LS   RNM LK+IKR
Sbjct: 368 QVKATIISEQQAKSLLKNENT-RNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKR 426

Query: 198 RPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWD 257
             ++RG ESV +EKF++ F S FS+GG ELVFQV TLSLPVVVIVHG+Q+ NA AT+ WD
Sbjct: 427 -SDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWD 485

Query: 258 NAFAEPGRSPFVVPDKRPWKMIADVLMMKF--ESATGRTLDAENLNFLAEKAFRQATDIK 315
           NAFAEPGR PF VPDK  W  + + L MKF  E  + R L  ENL FLA+K F    +I 
Sbjct: 486 NAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLF----NIS 541

Query: 316 MAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKR 375
                DY++M ++WSQF +E LP R++TFW WF  VM++ ++HLK  W DG I+GFV K+
Sbjct: 542 SNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQ 601

Query: 376 KAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKR 412
           +A ++L ++  GTFLLRFSDSE+GGITIAWK   ++R
Sbjct: 602 QAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQER 638
Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.
Mus musculus (taxid: 10090)
>sp|P51692|STA5B_HUMAN Signal transducer and activator of transcription 5B OS=Homo sapiens GN=STAT5B PE=1 SV=2 Back     alignment and function description
>sp|Q9TUZ0|STA5B_PIG Signal transducer and activator of transcription 5B OS=Sus scrofa GN=STAT5B PE=2 SV=1 Back     alignment and function description
>sp|Q9TUM3|STA5B_BOVIN Signal transducer and activator of transcription 5B OS=Bos taurus GN=STAT5B PE=2 SV=2 Back     alignment and function description
>sp|P52632|STA5B_RAT Signal transducer and activator of transcription 5B OS=Rattus norvegicus GN=Stat5b PE=2 SV=1 Back     alignment and function description
>sp|Q9TUZ1|STA5A_PIG Signal transducer and activator of transcription 5A OS=Sus scrofa GN=STAT5A PE=2 SV=1 Back     alignment and function description
>sp|Q62771|STA5A_RAT Signal transducer and activator of transcription 5A OS=Rattus norvegicus GN=Stat5a PE=1 SV=1 Back     alignment and function description
>sp|P42229|STA5A_HUMAN Signal transducer and activator of transcription 5A OS=Homo sapiens GN=STAT5A PE=1 SV=1 Back     alignment and function description
>sp|P42230|STA5A_MOUSE Signal transducer and activator of transcription 5A OS=Mus musculus GN=Stat5a PE=1 SV=1 Back     alignment and function description
>sp|P42231|STA5A_SHEEP Signal transducer and activator of transcription 5A OS=Ovis aries GN=STAT5A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
340725344 824 PREDICTED: signal transducer and activat 0.529 0.320 0.714 1e-109
48141041 824 PREDICTED: signal transducer and activat 0.529 0.320 0.714 1e-108
380016406 775 PREDICTED: signal transducer and activat 0.529 0.340 0.714 1e-108
345485405 825 PREDICTED: signal transducer and activat 0.529 0.32 0.703 1e-108
383860846 827 PREDICTED: signal transducer and activat 0.529 0.319 0.707 1e-108
307174070 817 Signal transducer and activator of trans 0.525 0.320 0.713 1e-107
307203829 820 Signal transducer and activator of trans 0.523 0.318 0.711 1e-106
242013973 791 Signal transducer and activator of trans 0.529 0.333 0.691 1e-105
332023016 835 Signal transducer and activator of trans 0.531 0.317 0.696 1e-105
197361188 774 signal transducer and activator of trans 0.521 0.335 0.681 1e-102
>gi|340725344|ref|XP_003401031.1| PREDICTED: signal transducer and activator of transcription 5B-like [Bombus terrestris] gi|350403859|ref|XP_003486926.1| PREDICTED: signal transducer and activator of transcription 5B-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 226/270 (83%), Gaps = 6/270 (2%)

Query: 139 VKAQIICESQANALLKNEKIGKS-DASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKR 197
           VK  II E+QANALLK++K+ K+ +ASGEILNN G MEY+  ++ LS+S RNMQLKKIKR
Sbjct: 375 VKVSIISEAQANALLKSDKMAKNGEASGEILNNTGTMEYHQATRQLSVSFRNMQLKKIKR 434

Query: 198 RPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWD 257
             EK+GTESVMDEKFSL F S FS+GGGELVF VWTLSLPVVVIVHGNQEP+A AT+TWD
Sbjct: 435 -AEKKGTESVMDEKFSLLFQSQFSVGGGELVFAVWTLSLPVVVIVHGNQEPHAWATVTWD 493

Query: 258 NAFAEPGRSPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKMA 317
           NAFAEPGR PF VPDK PW  +A+ L +KF+SATGR+L  +NL FLAEKAFR       A
Sbjct: 494 NAFAEPGRVPFAVPDKVPWGQVAEALNVKFKSATGRSLTEDNLRFLAEKAFRGGN----A 549

Query: 318 ECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRKA 377
              DYS++LL+W+QFCKEPLP+R+FTFW+WFYAVMKLTREHLK+ W DG+I+GFVRKR+A
Sbjct: 550 SGQDYSSLLLSWAQFCKEPLPERNFTFWEWFYAVMKLTREHLKSQWMDGYILGFVRKRQA 609

Query: 378 EEMLASQVKGTFLLRFSDSELGGITIAWKG 407
           EEMLAS   GTFL+RFSDSELGG+TIAW G
Sbjct: 610 EEMLASCASGTFLMRFSDSELGGVTIAWVG 639

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|48141041|ref|XP_397181.1| PREDICTED: signal transducer and activator of transcription 5B [Apis mellifera] Back     alignment and taxonomy information
>gi|380016406|ref|XP_003692176.1| PREDICTED: signal transducer and activator of transcription 5B-like [Apis florea] Back     alignment and taxonomy information
>gi|345485405|ref|XP_001605495.2| PREDICTED: signal transducer and activator of transcription 5B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383860846|ref|XP_003705899.1| PREDICTED: signal transducer and activator of transcription 5B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307174070|gb|EFN64757.1| Signal transducer and activator of transcription 5B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307203829|gb|EFN82765.1| Signal transducer and activator of transcription 5B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242013973|ref|XP_002427673.1| Signal transducer and activator of transcription 5B, putative [Pediculus humanus corporis] gi|212512103|gb|EEB14935.1| Signal transducer and activator of transcription 5B, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332023016|gb|EGI63281.1| Signal transducer and activator of transcription 5B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|197361188|gb|ACH70130.1| signal transducer and activator of transcription [Fenneropenaeus chinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
ZFIN|ZDB-GENE-030820-2785 stat5.1 "signal transducer and 0.573 0.364 0.555 2.7e-77
UNIPROTKB|F1S0Q9787 STAT5B "Signal transducer and 0.537 0.340 0.565 6.3e-76
UNIPROTKB|F1P2T7788 STAT5B "Uncharacterized protei 0.685 0.434 0.472 1e-75
UNIPROTKB|O93378787 Stat5 "Signal transducer and a 0.685 0.434 0.472 1e-75
UNIPROTKB|F1PNW8793 STAT5B "Uncharacterized protei 0.537 0.337 0.561 1e-75
UNIPROTKB|Q9TUZ0787 STAT5B "Signal transducer and 0.537 0.340 0.561 1e-75
ZFIN|ZDB-GENE-040818-1787 stat5.2 "signal transducer and 0.541 0.343 0.557 1e-75
MGI|MGI:103035786 Stat5b "signal transducer and 0.537 0.340 0.565 1.3e-75
UNIPROTKB|P51692787 STAT5B "Signal transducer and 0.537 0.340 0.561 1.3e-75
UNIPROTKB|Q9TUM3787 STAT5B "Signal transducer and 0.537 0.340 0.561 1.3e-75
ZFIN|ZDB-GENE-030820-2 stat5.1 "signal transducer and activator of transcription 5.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 778 (278.9 bits), Expect = 2.7e-77, P = 2.7e-77
 Identities = 165/297 (55%), Positives = 205/297 (69%)

Query:   139 VKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRR 198
             VKA II E QA ALL+NE   ++D+SGEILNN  VMEY+  +  LS   RNM LK+I RR
Sbjct:   369 VKATIISEQQAKALLENENT-RNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKRI-RR 426

Query:   199 PEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDN 258
              ++RG ESV +EKF++ F S FS+GG EL FQV TLSLPVVVIVHG+Q+ NA AT+ WDN
Sbjct:   427 SDRRGAESVTEEKFTILFESQFSVGGNELGFQVKTLSLPVVVIVHGSQDNNATATVLWDN 486

Query:   259 AFAEPGRSPFVVPDKRPWKMIADVLMMKF--ESATGRTLDAENLNFLAEKAFRQATDIKM 316
             AFAEPGR PF+VPDK  W  + + L MK+  E  + R L  ENL FLA+KAF  ++    
Sbjct:   487 AFAEPGRVPFIVPDKVLWAQLCEALNMKYKAEVQSNRGLCEENLVFLAQKAFSSSS---- 542

Query:   317 AECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRK 376
                 DY NM + WSQF +E LP R+FTFW WF  VM+LT++HLK  W DG I+GFV K++
Sbjct:   543 VNPDDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNKQQ 602

Query:   377 AEEMLASQVKGTFLLRFSDSELGGITIAWKG-GPEKRGTVSVMDEKFSLYFSSTFSI 432
             A+ ML S+  GTF+LRFSDSE+GGITIAW    P K G   V +   + Y +  FSI
Sbjct:   603 AQNMLMSKPTGTFVLRFSDSEIGGITIAWVAENPNKAGERMVWN--LTPYTTKDFSI 657
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0030218 "erythrocyte differentiation" evidence=IGI;IMP
GO:0007259 "JAK-STAT cascade" evidence=IGI;IMP
GO:0005622 "intracellular" evidence=IGI;IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0030098 "lymphocyte differentiation" evidence=IMP
GO:0045639 "positive regulation of myeloid cell differentiation" evidence=IMP
GO:0048821 "erythrocyte development" evidence=IMP
UNIPROTKB|F1S0Q9 STAT5B "Signal transducer and activator of transcription 5B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2T7 STAT5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O93378 Stat5 "Signal transducer and activator of transcription 5B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNW8 STAT5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TUZ0 STAT5B "Signal transducer and activator of transcription 5B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040818-1 stat5.2 "signal transducer and activator of transcription 5.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:103035 Stat5b "signal transducer and activator of transcription 5B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P51692 STAT5B "Signal transducer and activator of transcription 5B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TUM3 STAT5B "Signal transducer and activator of transcription 5B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51692STA5B_HUMANNo assigned EC number0.55950.53900.3418yesN/A
P52632STA5B_RATNo assigned EC number0.55590.53900.3422yesN/A
Q9TUM3STA5B_BOVINNo assigned EC number0.55950.53900.3418yesN/A
P42232STA5B_MOUSENo assigned EC number0.56310.53900.3422yesN/A
Q9TUZ0STA5B_PIGNo assigned EC number0.55950.53900.3418yesN/A
Q24151STAT_DROMENo assigned EC number0.52360.50900.3337yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
pfam02864254 pfam02864, STAT_bind, STAT protein, DNA binding do 3e-74
cd09919115 cd09919, SH2_STAT_family, Src homology 2 (SH2) dom 5e-40
cd10376137 cd10376, SH2_STAT5, Src homology 2 (SH2) domain fo 1e-33
cd10420145 cd10420, SH2_STAT5b, Src homology 2 (SH2) domain f 1e-30
cd10421140 cd10421, SH2_STAT5a, Src homology 2 (SH2) domain f 3e-29
cd10377129 cd10377, SH2_STAT6, Src homology 2 (SH2) domain fo 3e-28
cd09919115 cd09919, SH2_STAT_family, Src homology 2 (SH2) dom 6e-27
cd10376137 cd10376, SH2_STAT5, Src homology 2 (SH2) domain fo 3e-19
cd10377129 cd10377, SH2_STAT6, Src homology 2 (SH2) domain fo 4e-19
cd10420145 cd10420, SH2_STAT5b, Src homology 2 (SH2) domain f 1e-18
cd10373151 cd10373, SH2_STAT2, Src homology 2 (SH2) domain fo 5e-18
cd10421140 cd10421, SH2_STAT5a, Src homology 2 (SH2) domain f 2e-17
cd10375148 cd10375, SH2_STAT4, Src homology 2 (SH2) domain fo 2e-15
cd10372151 cd10372, SH2_STAT1, Src homology 2 (SH2) domain fo 3e-13
cd10375148 cd10375, SH2_STAT4, Src homology 2 (SH2) domain fo 2e-12
cd10374162 cd10374, SH2_STAT3, Src homology 2 (SH2) domain fo 2e-12
cd10373151 cd10373, SH2_STAT2, Src homology 2 (SH2) domain fo 3e-12
cd10372151 cd10372, SH2_STAT1, Src homology 2 (SH2) domain fo 5e-12
cd10374162 cd10374, SH2_STAT3, Src homology 2 (SH2) domain fo 1e-11
pfam0001777 pfam00017, SH2, SH2 domain 1e-06
pfam0001777 pfam00017, SH2, SH2 domain 3e-06
smart0025284 smart00252, SH2, Src homology 2 domains 7e-06
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 1e-05
smart0025284 smart00252, SH2, Src homology 2 domains 2e-04
cd1034977 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f 2e-04
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 3e-04
cd10417102 cd10417, SH2_SH2D7, Src homology 2 domain found in 0.002
cd10356113 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai 0.003
>gnl|CDD|145817 pfam02864, STAT_bind, STAT protein, DNA binding domain Back     alignment and domain information 
 Score =  234 bits (599), Expect = 3e-74
 Identities = 87/220 (39%), Positives = 124/220 (56%), Gaps = 15/220 (6%)

Query: 139 VKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRR 198
           V  +I+ E QA    +   I  +  + +ILN    M  +  ++   ++LR  +LKK KR 
Sbjct: 47  VIDKIVSEKQAQRGFRKFNILGT--NTKILNMEESMNGSLAAEFRHLTLREQRLKKGKR- 103

Query: 199 PEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDN 258
             ++G  SV +E  ++ F + F++ G  L   + TLSLPVVVI +GNQ PNA A+I W N
Sbjct: 104 ANRKGPLSVTEELHAILFETQFTVQG--LKIDLETLSLPVVVISNGNQLPNAWASILWYN 161

Query: 259 AFAEPGR--SPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQATDIKM 316
           A  E  R    F+VP +  W  +++VL  +F S  GR L+ E L FLAEK F Q      
Sbjct: 162 ALTEDPRNLVFFLVPPRVTWAQLSEVLSWQFSSEVGRGLNIEQLGFLAEKLFGQ------ 215

Query: 317 AECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTR 356
              + YS   ++WSQFCKE LP +SFTFW WF A++ L +
Sbjct: 216 --NSSYSGGSISWSQFCKENLPGKSFTFWQWFDAILDLVK 253

STAT proteins (Signal Transducers and Activators of Transcription) are a family of transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors. This family represents the DNA binding domain of STAT, which has an ig-like fold. STAT proteins also include an SH2 domain pfam00017. Length = 254
>gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) family Back     alignment and domain information
>gnl|CDD|198239 cd10376, SH2_STAT5, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5 proteins Back     alignment and domain information
>gnl|CDD|198283 cd10420, SH2_STAT5b, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5b proteins Back     alignment and domain information
>gnl|CDD|198284 cd10421, SH2_STAT5a, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5a proteins Back     alignment and domain information
>gnl|CDD|198240 cd10377, SH2_STAT6, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 6 proteins Back     alignment and domain information
>gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) family Back     alignment and domain information
>gnl|CDD|198239 cd10376, SH2_STAT5, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5 proteins Back     alignment and domain information
>gnl|CDD|198240 cd10377, SH2_STAT6, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 6 proteins Back     alignment and domain information
>gnl|CDD|198283 cd10420, SH2_STAT5b, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5b proteins Back     alignment and domain information
>gnl|CDD|198236 cd10373, SH2_STAT2, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 2 proteins Back     alignment and domain information
>gnl|CDD|198284 cd10421, SH2_STAT5a, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 5a proteins Back     alignment and domain information
>gnl|CDD|198238 cd10375, SH2_STAT4, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 4proteins Back     alignment and domain information
>gnl|CDD|198235 cd10372, SH2_STAT1, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 1 proteins Back     alignment and domain information
>gnl|CDD|198238 cd10375, SH2_STAT4, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 4proteins Back     alignment and domain information
>gnl|CDD|198237 cd10374, SH2_STAT3, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 3 proteins Back     alignment and domain information
>gnl|CDD|198236 cd10373, SH2_STAT2, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 2 proteins Back     alignment and domain information
>gnl|CDD|198235 cd10372, SH2_STAT1, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 1 proteins Back     alignment and domain information
>gnl|CDD|198237 cd10374, SH2_STAT3, Src homology 2 (SH2) domain found in signal transducer and activator of transcription (STAT) 3 proteins Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) Back     alignment and domain information
>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 499
PF02864254 STAT_bind: STAT protein, DNA binding domain; Inter 100.0
KOG3667|consensus682 100.0
KOG3667|consensus682 99.82
KOG2362|consensus336 99.79
COG3217270 Uncharacterized Fe-S protein [General function pre 99.71
PLN02724805 Molybdenum cofactor sulfurase 99.68
PF03473133 MOSC: MOSC domain; InterPro: IPR005302 Molybdenum 99.38
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 97.51
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 97.4
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 97.19
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 97.18
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 96.83
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 96.76
KOG3601|consensus222 92.4
PRK14499308 molybdenum cofactor biosynthesis protein MoaC/MOSC 91.93
KOG4637|consensus 464 90.79
PF02864254 STAT_bind: STAT protein, DNA binding domain; Inter 88.95
KOG1785|consensus 563 88.12
PF0276185 Cbl_N2: CBL proto-oncogene N-terminus, EF hand-lik 84.44
KOG2142|consensus728 80.88
>PF02864 STAT_bind: STAT protein, DNA binding domain; InterPro: IPR013801 The STAT protein (Signal Transducers and Activators of Transcription) family contains transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors, hence they act as signal transducers in the cytoplasm and transcription activators in the nucleus [] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-65  Score=504.46  Aligned_cols=211  Identities=52%  Similarity=0.927  Sum_probs=183.6

Q ss_pred             CCCCccceEEeehhhhhhhhhcccCCCCCcccccccccccceeecCCCceEEEecccchhhhhccCCCCCCcccccceeE
Q psy15307        134 RDTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFS  213 (499)
Q Consensus       134 ~~~p~Vk~~i~~e~qa~~~~~~~~~~~~~~~g~iln~~~~me~~~~~g~l~a~Fr~~~Lk~~kr~~~~~g~~~Vteek~~  213 (499)
                      ..++.|.++|++|.||+.+.++....  +++++|+|+++.|+++...+.+++.||||++++++| +++||+++||||||+
T Consensus        42 l~~~~v~~~ii~e~qa~~~~r~~~~~--~~~skiln~~~~~~~~~~~~f~~l~fk~~kl~k~~R-~~~kg~~sVTEEk~~  118 (254)
T PF02864_consen   42 LKVPVVFDKIISESQARKLFRKFNIL--GTNSKILNNEESMEGHLSAEFLHLTFKNMKLKKIKR-GDRKGSESVTEEKFA  118 (254)
T ss_dssp             CEEEEEESCCCCTCCSCCSHTTEEEC--SSSEEEECETTCSCTCEEEEEEEEEEEEE-CSSTT---SGCCTSSGGG-EEE
T ss_pred             ccCceEEEeecchHHHHHhhhcCccC--CCchhhcccccccccccccccccceeehhhcccccc-cccccchhHhhhhhe
Confidence            38899999999999999876665543  444499999999999988999999999999999999 899999999999999


Q ss_pred             EEEEEEEEeCCceEEEEEeecCCCEEEEECCCcCccchhhhHHhhhcCCCCC--CCCCCCCCCchhhHHHHHHhhccccc
Q psy15307        214 LYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGR--SPFVVPDKRPWKMIADVLMMKFESAT  291 (499)
Q Consensus       214 l~F~~~f~~~g~el~~~~~t~SLPvVVI~~~~Q~~~a~atIlW~n~f~~~~r--~~F~~p~~v~W~~l~~~L~~~F~~~t  291 (499)
                      |+|+++|+++|  |+|+|||+|||||||||+||+++|||||+|||||+++.|  .+|.+|++|+|+||+++|+|||++++
T Consensus       119 ilF~t~f~~~g--l~~~l~t~SLPvVVIvh~nQ~~~AwAtIlWdN~fs~~~rn~~~F~~p~~v~W~ql~~~L~~~F~~~~  196 (254)
T PF02864_consen  119 ILFETQFSVGG--LVFDLWTLSLPVVVIVHGNQEPSAWATILWDNAFSSDPRNLNPFVVPPKVPWPQLSEALSWQFSSET  196 (254)
T ss_dssp             EEEEEEEEESS--EEEEEEEEESEEEEESSCCCHHHHHHHHHHHHHH--TSS-STGTCS-SEEEHHHHHHHHHHHHHHHS
T ss_pred             EEEEEEEEECC--EEEEEEeccCCEEEEecCccchhhhHhhhhhhhcccCCCCccccCCCCcccHHHHHHHHHHHHHHhh
Confidence            99999999998  799999999999999999999999999999999998878  77999999999999999999999999


Q ss_pred             CCCCChhhHHHHHHHHhccccccccccccCcCcccccccccccCCCCCCCCchHHhHHHHHHHHhh
Q psy15307        292 GRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTRE  357 (499)
Q Consensus       292 ~R~L~~~~l~~L~~kl~~~~~~~~~~~~~~~~~~~Vsw~~F~Ke~lp~~~ftFW~Wf~~il~lik~  357 (499)
                      +|||+++||.||++||||.+     .   .++++.|||+|||||++||++||||+|||+||+|||+
T Consensus       197 ~R~L~~~~L~~L~~Kl~~~~-----~---~~~~~~isw~~F~Ke~lp~~~ftFW~Wf~~ilelikk  254 (254)
T PF02864_consen  197 GRGLTDEQLQYLAEKLFGQN-----S---SYNNMLISWSQFCKENLPGRNFTFWEWFDGILELIKK  254 (254)
T ss_dssp             S----HHHHHHHHHHHHTSS-----S----GCC-EEEHHHHHTSB-TTSSSBHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHhCCc-----c---cCCCceeEHHHhhhccCCCCCCchHHHHHHHHHHhcC
Confidence            99999999999999999872     2   2567899999999999999999999999999999986

Binding of these factors to cell-surface receptors leads to receptor autophosphorylation at a tyrosine, the phosphotyrosine being recognised by the STAT SH2 domain, which mediates the recruitment of STAT proteins from the cytosol and their association with the activated receptor. The STAT proteins are then activated by phosphorylation via members of the JAK family of protein kinases, causing them to dimerise and translocated to the nucleus, where they bind to specific promoter sequences in target genes. In mammals, STATs comprise a family of seven structurally and functionally related proteins: Stat1, Stat2, Stat3, Stat4, Stat5a and Stat5b, Stat6. STAT proteins play a critical role in regulating innate and acquired host immune responses. Dysregulation of at least two STAT signalling cascades (i.e. Stat3 and Stat5) is associated with cellular transformation. Signalling through the JAK/STAT pathway is initiated when a cytokine binds to its corresponding receptor. This leads to conformational changes in the cytoplasmic portion of the receptor, initiating activation of receptor associated members of the JAK family of kinases. The JAKs, in turn, mediate phosphorylation at the specific receptor tyrosine residues, which then serve as docking sites for STATs and other signalling molecules. Once recruited to the receptor, STATs also become phosphorylated by JAKs, on a single tyrosine residue. Activated STATs dissociate from the receptor, dimerise, translocate to the nucleus and bind to members of the GAS (gamma activated site) family of enhancers. The seven STAT proteins identified in mammals range in size from 750 and 850 amino acids. The chromosomal distribution of these STATs, as well as the identification of STATs in more primitive eukaryotes, suggest that this family arose from a single primordial gene. STATs share structurally and functionally conserved domains including: an N-terminal domain that strengthens interactions between STAT dimers on adjacent DNA-binding sites; a coiled-coil STAT domain that is implicated in protein-protein interactions; a DNA-binding domain with an immunoglobulin-like fold similar to p53 tumour suppressor protein; an EF-hand-like linker domain connecting the DNA-binding and SH2 domains; an SH2 domain (IPR000980 from INTERPRO) that acts as a phosphorylation-dependent switch to control receptor recognition and DNA-binding; and a C-terminal transactivation domain []. The crystal structure of the N terminus of Stat4 reveals a dimer. The interface of this dimer is formed by a ring-shaped element consisting of five short helices. Several studies suggest that this N-terminal dimerisation promotes cooperativity of binding to tandem GAS elements and with the transcriptional coactivator CBP/p300. This entry represents the DNA-binding domain, which has an immunoglobulin-like structural fold.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0004871 signal transducer activity, 0006355 regulation of transcription, DNA-dependent, 0007165 signal transduction, 0005634 nucleus; PDB: 1YVL_A 1BF5_A 1Y1U_B 3CWG_B 1BG1_A.
>KOG3667|consensus Back     alignment and domain information
>KOG3667|consensus Back     alignment and domain information
>KOG2362|consensus Back     alignment and domain information
>COG3217 Uncharacterized Fe-S protein [General function prediction only] Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PF03473 MOSC: MOSC domain; InterPro: IPR005302 Molybdenum cofactor (MOCO) sulphurases [] catalyse the insertion of a terminal sulphur ligand into the molybdenum cofactor, thereby converting the oxo form of MOCO to a sulphurylated form Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PRK14499 molybdenum cofactor biosynthesis protein MoaC/MOSC-domain-containing protein; Provisional Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>PF02864 STAT_bind: STAT protein, DNA binding domain; InterPro: IPR013801 The STAT protein (Signal Transducers and Activators of Transcription) family contains transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors, hence they act as signal transducers in the cytoplasm and transcription activators in the nucleus [] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF02761 Cbl_N2: CBL proto-oncogene N-terminus, EF hand-like domain; InterPro: IPR014741 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface Back     alignment and domain information
>KOG2142|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
1y1u_A585 Structure Of Unphosphorylated Stat5a Length = 585 3e-79
1y1u_A 585 Structure Of Unphosphorylated Stat5a Length = 585 1e-04
1bf5_A575 Tyrosine Phosphorylated Stat-1DNA COMPLEX Length = 1e-31
1yvl_A683 Structure Of Unphosphorylated Stat1 Length = 683 3e-31
1bg1_A596 Transcription Factor Stat3bDNA COMPLEX Length = 596 3e-28
3cwg_A562 Unphosphorylated Mouse Stat3 Core Fragment Length = 3e-28
1uur_A473 Structure Of An Activated Dictyostelium Stat In Its 1e-06
>pdb|1Y1U|A Chain A, Structure Of Unphosphorylated Stat5a Length = 585 Back     alignment and structure 
Iteration: 1

 Score =  292 bits (747), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 151/271 (55%), Positives = 191/271 (70%), Gaps = 8/271 (2%)
Query: 138 SVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKR 197
            VKA II E QA +LLKNE   +++ SGEILNN  VMEY+  +  LS   RNM LK+IKR
Sbjct: 241 QVKATIISEQQAKSLLKNENT-RNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKR 299
Query: 198 RPEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWD 257
             ++RG ESV +EKF++ F S FS+G  ELVFQV TLSLPVVVIVHG+Q+ NA AT+ WD
Sbjct: 300 -ADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWD 358
Query: 258 NAFAEPGRSPFVVPDKRPWKMIADVLMMKF--ESATGRTLDAENLNFLAEKAFRQATDIK 315
           NAFAEPGR PF VPDK  W  + + L MKF  E  + R L  ENL FLA+K F    +I 
Sbjct: 359 NAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLF----NIS 414
Query: 316 MAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKR 375
                DY++M ++WSQF +E LP  ++TFW WF  VM++ ++H K  W DG I+GFV K+
Sbjct: 415 SNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQ 474
Query: 376 KAEEMLASQVKGTFLLRFSDSELGGITIAWK 406
           +A ++L ++  GTFLLRFSDSE+GGITIAWK
Sbjct: 475 QAHDLLINKPDGTFLLRFSDSEIGGITIAWK 505
>pdb|1Y1U|A Chain A, Structure Of Unphosphorylated Stat5a Length = 585 Back     alignment and structure
>pdb|1BF5|A Chain A, Tyrosine Phosphorylated Stat-1DNA COMPLEX Length = 575 Back     alignment and structure
>pdb|1YVL|A Chain A, Structure Of Unphosphorylated Stat1 Length = 683 Back     alignment and structure
>pdb|1BG1|A Chain A, Transcription Factor Stat3bDNA COMPLEX Length = 596 Back     alignment and structure
>pdb|3CWG|A Chain A, Unphosphorylated Mouse Stat3 Core Fragment Length = 562 Back     alignment and structure
>pdb|1UUR|A Chain A, Structure Of An Activated Dictyostelium Stat In Its Dna-Unbound Form Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
1y1u_A585 Signal transducer and activator of transcription; 1e-107
1y1u_A585 Signal transducer and activator of transcription; 6e-41
1y1u_A 585 Signal transducer and activator of transcription; 4e-04
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 1e-93
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 4e-31
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 4e-04
1yvl_A683 Signal transducer and activator of transcription 1 1e-88
1yvl_A683 Signal transducer and activator of transcription 1 1e-26
1bf5_A575 Signal transducer and activator of transcription 1 2e-86
1bf5_A575 Signal transducer and activator of transcription 1 1e-29
1uur_A473 Stata protein, STAT protein; transcription activat 2e-48
1uur_A473 Stata protein, STAT protein; transcription activat 2e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
 Score =  329 bits (843), Expect = e-107
 Identities = 150/282 (53%), Positives = 193/282 (68%), Gaps = 8/282 (2%)

Query: 139 VKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRR 198
           VKA II E QA +LLKNE   +++ SGEILNN  VMEY+  +  LS   RNM LK+IKR 
Sbjct: 242 VKATIISEQQAKSLLKNENT-RNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKR- 299

Query: 199 PEKRGTESVMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDN 258
            ++RG ESV +EKF++ F S FS+G  ELVFQV TLSLPVVVIVHG+Q+ NA AT+ WDN
Sbjct: 300 ADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDN 359

Query: 259 AFAEPGRSPFVVPDKRPWKMIADVLMMKFES--ATGRTLDAENLNFLAEKAFRQATDIKM 316
           AFAEPGR PF VPDK  W  + + L MKF++   + R L  ENL FLA+K F        
Sbjct: 360 AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNI----SS 415

Query: 317 AECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFVRKRK 376
               DY++M ++WSQF +E LP  ++TFW WF  VM++ ++H K  W DG I+GFV K++
Sbjct: 416 NHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQ 475

Query: 377 AEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVM 418
           A ++L ++  GTFLLRFSDSE+GGITIAWK     R   ++ 
Sbjct: 476 AHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLK 517
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
1y1u_A585 Signal transducer and activator of transcription; 100.0
1bf5_A575 Signal transducer and activator of transcription 1 100.0
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 100.0
1yvl_A683 Signal transducer and activator of transcription 1 100.0
1uur_A473 Stata protein, STAT protein; transcription activat 100.0
1bf5_A575 Signal transducer and activator of transcription 1 99.96
1y1u_A585 Signal transducer and activator of transcription; 99.96
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 99.95
1yvl_A683 Signal transducer and activator of transcription 1 99.93
1uur_A473 Stata protein, STAT protein; transcription activat 99.92
3op0_A323 Signal transduction protein CBL-C; structural geno 98.55
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 98.38
1oru_A195 YUAD protein; structural genomics, cytosolic hypot 98.23
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 96.99
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 96.94
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 96.9
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 96.88
1o65_A 246 Hypothetical protein YIIM; structural genomics, un 96.87
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 96.77
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 96.73
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 96.7
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 96.66
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 96.64
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 96.62
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 96.62
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 96.58
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 96.53
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 96.51
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 96.45
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 96.45
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 96.44
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 96.42
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 96.41
2dly_A121 FYN-related kinase; BRK family kinase, structural 96.41
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 96.38
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 96.35
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 96.34
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 96.33
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 96.32
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 96.28
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 96.25
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 96.16
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 96.12
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 96.04
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 96.02
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 95.98
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 95.97
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.92
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 95.86
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 95.83
2aug_A126 Growth factor receptor-bound protein 14; phosphory 95.74
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 95.69
2vif_A141 Suppressor of cytokine signalling 6; growth regula 95.68
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 95.66
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 95.63
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 95.59
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 95.56
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 95.55
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 95.29
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.15
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 95.08
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 94.93
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 94.81
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 94.76
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 94.76
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 94.74
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 94.64
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 94.5
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 94.39
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 94.28
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 94.21
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 94.21
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 94.17
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 94.12
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 94.06
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 94.03
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 93.94
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 93.94
2oq1_A 254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 93.92
2vif_A141 Suppressor of cytokine signalling 6; growth regula 93.91
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 93.65
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 93.58
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 93.56
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 93.45
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 92.51
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 93.22
1a81_A 254 SYK kinase; complex (transferase-peptide), SYK, ki 93.1
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 93.08
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 92.98
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 92.97
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 92.96
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 92.96
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 92.91
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 92.68
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 92.65
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 92.53
3op0_A323 Signal transduction protein CBL-C; structural geno 92.47
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 92.46
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 92.44
2dly_A121 FYN-related kinase; BRK family kinase, structural 92.38
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 92.34
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 92.11
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 92.08
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 92.03
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 92.01
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 91.91
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 91.82
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 91.73
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 91.66
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 91.65
2aug_A126 Growth factor receptor-bound protein 14; phosphory 91.63
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 91.48
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 91.37
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 91.22
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 91.03
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 90.94
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 90.88
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 90.83
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 90.66
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 90.53
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 90.31
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 90.28
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 90.22
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 90.16
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 89.96
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 89.87
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 89.64
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 89.21
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 88.83
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 88.61
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 88.5
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 88.45
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 88.21
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 87.21
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 87.04
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 86.89
3maz_A125 Signal-transducing adaptor protein 1; modular doma 86.56
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 86.47
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 86.36
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 86.22
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 86.21
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 85.69
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 84.74
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 84.97
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 84.44
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 83.91
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 83.13
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 82.26
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 81.52
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 80.36
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=1.8e-79  Score=663.17  Aligned_cols=279  Identities=54%  Similarity=0.897  Sum_probs=255.3

Q ss_pred             CCCccceEEeehhhhhhhhhcccCCCCCcccccccccccceeecCCCceEEEecccchhhhhccCCCCCCcccccceeEE
Q psy15307        135 DTASVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEYNTHSKVLSISLRNMQLKKIKRRPEKRGTESVMDEKFSL  214 (499)
Q Consensus       135 ~~p~Vk~~i~~e~qa~~~~~~~~~~~~~~~g~iln~~~~me~~~~~g~l~a~Fr~~~Lk~~kr~~~~~g~~~Vteek~~l  214 (499)
                      +||+|+|+||+|.||+.+++|+...+ +.+|+|+||+++|+|++.+|+|+|+||||+|||||| +++||+++||||||+|
T Consensus       238 ~~~~V~~~i~~e~~a~~~~~~~~~~~-~~~g~I~n~~~~m~~~~~~g~l~a~Fr~l~lk~~kr-~~~kg~e~Vteek~~l  315 (585)
T 1y1u_A          238 NPPQVKATIISEQQAKSLLKNENTRN-ECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKR-ADRRGAESVTEEKFTV  315 (585)
T ss_dssp             SCCBEEEEEEEHHHHHHHHTTCCCTT-CCTTCCBSCCCBCEEETTTTEEECEEEEECBCC----------CCGGGCEEEE
T ss_pred             CCceeEEEEecchhhhhhcccccccc-ccccccccCceeeeeecCCCceeEEecCceeeeecc-cCCCCcceeecceeeE
Confidence            78999999999999999999987664 789999999999999988999999999999999998 8999999999999999


Q ss_pred             EEEEEEEeCCceEEEEEeecCCCEEEEECCCcCccchhhhHHhhhcCCCCCCCCCCCCCCchhhHHHHHHhhcccc--cC
Q psy15307        215 YFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSPFVVPDKRPWKMIADVLMMKFESA--TG  292 (499)
Q Consensus       215 ~F~~~f~~~g~el~~~~~t~SLPvVVI~~~~Q~~~a~atIlW~n~f~~~~r~~F~~p~~v~W~~l~~~L~~~F~~~--t~  292 (499)
                      +|+++|+++|++++|++||+|||||||||+||+++|||||+|||||++|+|+||.+|++|+|++|+++|+|+|++.  ++
T Consensus       316 ~F~~~~~~~~~~l~~~~~t~SLPvVVI~~~~Q~~~A~atIlW~n~f~~~~r~~F~vP~~v~W~ql~~~L~~~F~s~v~t~  395 (585)
T 1y1u_A          316 LFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSN  395 (585)
T ss_dssp             EEEEEEECSSSSCEEEEEEECSCEEEECSSCCHHHHHHHHHHHHHHCCTTCSTTCCCSEEEHHHHHHHHHHHHHHHHTSS
T ss_pred             EEEEEEEecCCceEEEEEecCCCEEEEECCCcCcchhHHHHHHHhhCCcccCCCcCCCCCcHHHHHHHHHHHhhhhcCCC
Confidence            9999999998889999999999999999999999999999999999999999999999999999999999999999  99


Q ss_pred             CCCChhhHHHHHHHHhccccccccccccCcCcccccccccccCCCCCCCCchHHhHHHHHHHHhhhcccccccceEEeee
Q psy15307        293 RTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREHLKNVWTDGHIMGFV  372 (499)
Q Consensus       293 R~L~~~~l~~L~~kl~~~~~~~~~~~~~~~~~~~Vsw~~F~Ke~lp~~~ftFW~Wf~~il~lik~hL~~lW~dg~I~GFi  372 (499)
                      |||+++||+||++|+|+..    .++..+++++.|||++||||++||++||||+|||+||+++|+||.++|+||+|+|||
T Consensus       396 R~Lt~~~L~~L~~Kl~~~~----~~~~~~~~~~~Vsw~qF~Ke~l~~~~ftFW~Wf~~ilelik~hL~~lW~dG~I~Gfi  471 (585)
T 1y1u_A          396 RGLTKENLVFLAQKLFNIS----SNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFV  471 (585)
T ss_dssp             CCCCHHHHHHHHHHHHTCC----CCSGGGGGGCEEEHHHHHTSBCTTSSSBHHHHHHHHHHHHHHHCHHHHHHTCCCBSC
T ss_pred             CCCCHHHHHHHHHHhcCCC----CCCcCCCccceeeHHHhccccCCCcccchHHHHHHHHHHHHHHHHhhhcccceEEec
Confidence            9999999999999999862    122356678899999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHhhCccceeEEeecCCCCCceeeeecCCCCccccccccc
Q psy15307        373 RKRKAEEMLASQVKGTFLLRFSDSELGGITIAWKGGPEKRGTVSVMD  419 (499)
Q Consensus       373 sk~ea~~~L~~~~~GtfLlRFSds~~g~iti~~v~~~~~r~V~~Vl~  419 (499)
                      +|++|+++|.++++||||+|||++..|+++++|+.+++++.++++.+
T Consensus       472 sk~~a~~~L~~~~~GtFLlRFSds~~G~~tisyv~~~~~~~v~~v~P  518 (585)
T 1y1u_A          472 NKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKP  518 (585)
T ss_dssp             CHHHHHHHHHTSCTTCEEEEEETTSTTEEEEEECCSSCCSSCSEEEE
T ss_pred             cHHHHHHHHhCCCCCceEEEeccCCcCcEEEEEEecCCCceeEeecC
Confidence            99999999999999999999999999999999999876666766543
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>1oru_A YUAD protein; structural genomics, cytosolic hypothetical protein, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.80A {Bacillus subtilis} SCOP: b.58.1.2 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1o65_A Hypothetical protein YIIM; structural genomics, unknown function; 2.33A {Escherichia coli} SCOP: b.58.1.2 PDB: 1o67_A Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 499
d1bf5a2252 b.2.5.5 (A:317-568) STAT-1, DNA-binding domain {Hu 7e-83
d1bg1a2254 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [ 5e-81
d1bg1a2254 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [ 4e-05
d1bf5a3142 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) 5e-36
d1bf5a3142 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) 2e-19
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 3e-29
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 2e-13
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 4e-20
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 7e-14
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 2e-04
>d1bf5a2 b.2.5.5 (A:317-568) STAT-1, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 252 Back     information, alignment and structure

class: All beta proteins
fold: Common fold of diphtheria toxin/transcription factors/cytochrome f
superfamily: p53-like transcription factors
family: STAT DNA-binding domain
domain: STAT-1, DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  255 bits (652), Expect = 7e-83
 Identities = 66/227 (29%), Positives = 108/227 (47%), Gaps = 21/227 (9%)

Query: 138 SVKAQIICESQANALLKNEKIGKSDASGEILNNMGVMEY-NTHSKVLSISLRNMQLKKIK 196
           ++K +++ +   N   +N   G       +  +  VM    + +  L+   R++QLK+ K
Sbjct: 41  NLKVKVLFDKDVNE--RNTVKGFRK-FNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQK 97

Query: 197 RRPEKRGTES---VMDEKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHAT 253
                R  E    V +E  SL F +     G  LV  + T SLPVVVI + +Q P+  A+
Sbjct: 98  N-AGTRTNEGPLIVTEELHSLSFETQLCQPG--LVIDLETTSLPVVVISNVSQLPSGWAS 154

Query: 254 ITWDNAFAEPGR--SPFVVPDKRPWKMIADVLMMKFESATGRTLDAENLNFLAEKAFRQA 311
           I W N      R  S F+ P    W  +++VL  +F S T R L+ + LN L EK     
Sbjct: 155 ILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGP- 213

Query: 312 TDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREH 358
                       + L+ W++FCKE + D++F FW W  ++++L ++H
Sbjct: 214 --------NASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKH 252
>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 254 Back     information, alignment and structure
>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 254 Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
d1bg1a2254 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1bf5a2252 STAT-1, DNA-binding domain {Human (Homo sapiens) [ 100.0
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.66
d1uura2217 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.65
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.13
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.06
d1orua_182 Hypothetical protein YuaD {Bacillus subtilis [TaxI 97.22
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 97.06
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 97.04
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 97.03
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 97.02
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 96.87
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 96.86
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 96.84
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 96.69
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 96.66
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 96.56
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 96.51
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 96.49
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 96.41
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 96.37
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 96.28
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 96.24
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 96.23
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 96.21
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 96.09
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 96.08
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 96.06
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 96.05
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 96.01
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 95.99
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 95.82
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 95.72
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 95.62
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 95.55
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 95.55
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 95.44
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 95.42
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 95.39
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 95.18
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 95.01
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 94.95
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 94.82
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 94.58
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 94.47
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 94.46
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 94.31
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 93.54
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 93.24
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 93.2
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 93.19
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 93.04
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 92.62
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 92.52
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 92.48
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 92.4
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 92.27
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 91.83
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 91.52
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 91.3
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 91.17
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 91.04
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 91.03
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 90.94
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 90.63
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 90.55
d1o65a_ 233 Hypothetical protein YiiM {Escherichia coli [TaxId 90.21
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 89.74
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 89.28
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 88.91
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 88.33
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 84.13
>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Common fold of diphtheria toxin/transcription factors/cytochrome f
superfamily: p53-like transcription factors
family: STAT DNA-binding domain
domain: STAT3b
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=7.2e-69  Score=525.15  Aligned_cols=207  Identities=30%  Similarity=0.496  Sum_probs=188.7

Q ss_pred             CCccceEEeehhhhhhhhhcccCCCCCcccccc-ccccccee-ecCCCceEEEecccchhhhhcc----CCCCCCccccc
Q psy15307        136 TASVKAQIICESQANALLKNEKIGKSDASGEIL-NNMGVMEY-NTHSKVLSISLRNMQLKKIKRR----PEKRGTESVMD  209 (499)
Q Consensus       136 ~p~Vk~~i~~e~qa~~~~~~~~~~~~~~~g~il-n~~~~me~-~~~~g~l~a~Fr~~~Lk~~kr~----~~~~g~~~Vte  209 (499)
                      ..+|++.|++|.++....+|.+.+      +|+ +++++|+| ++.+|+|+|+||||+|||||+.    +++||+++|||
T Consensus        40 ~~kvk~~~~~~~~~~~~~~~~~~~------~~l~~~~~~~~~e~~~~g~lsa~Frnl~Lkk~k~~~~gr~~~kg~~sVtE  113 (254)
T d1bg1a2          40 QLKIKVCIDKDSGDVAALRGSRKF------NILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTE  113 (254)
T ss_dssp             TCEEEEEESCGGGTSSSCCSCCCE------EEESCCEEECBCTTCSTTCEEEEEEEEEEEECCSSSCCCCSGGGTSCGGG
T ss_pred             cceEEEEEecchhhhhcccccccc------cccccCccccchhhcCCCceEEEecCcEeeeeecCCCCCccccCCeeehh
Confidence            458899999998887777777765      556 88899998 5679999999999999999931    78899999999


Q ss_pred             ceeEEEEEEEEEeCCceEEEEEeecCCCEEEEECCCcCccchhhhHHhhhcCCCCCCC--CCCCCCCchhhHHHHHHhhc
Q psy15307        210 EKFSLYFSSTFSIGGGELVFQVWTLSLPVVVIVHGNQEPNAHATITWDNAFAEPGRSP--FVVPDKRPWKMIADVLMMKF  287 (499)
Q Consensus       210 ek~~l~F~~~f~~~g~el~~~~~t~SLPvVVI~~~~Q~~~a~atIlW~n~f~~~~r~~--F~~p~~v~W~~l~~~L~~~F  287 (499)
                      |||+|+|+++|+++|  |+|+|||+||||||||||||+++|||||+|||||+++.|.+  |.+|++|+|++|+++|+|||
T Consensus       114 Ek~~l~F~t~~~~~~--l~~~l~tlSLPvVVIvhgnQ~~~AwATIlWdNafs~~~r~~~fF~vp~~v~W~~l~~~L~~kF  191 (254)
T d1bg1a2         114 ELHLITFETEVYHQG--LKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQF  191 (254)
T ss_dssp             CCBCEEEEEEEEETT--EEEEEEEECSCBEEESSGGGHHHHHHHHHHHHHHCCCSCCTTGGGSCCCEEHHHHHHHHHHHH
T ss_pred             heeeeEEEEEEeeCC--EEEEEEEccCCEEEEeCCCcCcCceeEeeEcccccCCCCCCccccCCCCCCHHHHHHHHhhhh
Confidence            999999999999997  79999999999999999999999999999999999754544  89999999999999999999


Q ss_pred             ccccCCCCChhhHHHHHHHHhccccccccccccCcCcccccccccccCCCCCCCCchHHhHHHHHHHHhhh
Q psy15307        288 ESATGRTLDAENLNFLAEKAFRQATDIKMAECADYSNMLLNWSQFCKEPLPDRSFTFWDWFYAVMKLTREH  358 (499)
Q Consensus       288 ~~~t~R~L~~~~l~~L~~kl~~~~~~~~~~~~~~~~~~~Vsw~~F~Ke~lp~~~ftFW~Wf~~il~lik~h  358 (499)
                      ++.++|||+++||.||++|+|+.        ..+++++.|||+|||||++||++||||+|||+||+|+|+|
T Consensus       192 ~~~t~rgL~~~~l~~L~~Kl~~~--------~~~~~~~~isW~~F~Ke~lp~r~FtFW~Wf~~ileL~KkH  254 (254)
T d1bg1a2         192 SSTTKRGLSIEQLTTLAEKLLGP--------GVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKY  254 (254)
T ss_dssp             HHHSSCCCCHHHHHHHHHHHHCS--------CSCCTTCEECHHHHTTSBCTTCSSBHHHHHHHHHHHHHHS
T ss_pred             hhhccCCCCHHHHHHHHHHhcCC--------CCCcccceecHHHhccccCCCCCcchHHHHHHHHHHhhcC
Confidence            99999999999999999999987        2466789999999999999999999999999999999998
>d1bf5a2 b.2.5.5 (A:317-568) STAT-1, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uura2 b.2.5.5 (A:360-576) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1orua_ b.58.1.2 (A:) Hypothetical protein YuaD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o65a_ b.58.1.2 (A:) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure