Diaphorina citri psyllid: psy15310


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MDQLLNTKIKALGQDRCQLADNLKETCFLIENTQGKILNVELLKWKREQQLQERRRLEAEEEVEEDIGKEHLYSHDPRALFKTIQACLTQEMRIVQQNDPHLYSHDPRALFKTIQACLTQEMRIVQQNDPVSNGARYNCTLDMIQGYCESLAEIIWMTRQQIKEAERLKNLISKYVDPPNMVDVLPNLNAQITQCLSHLVTSTFIIEKQPPQVMKTNTRFSATVRLLTGSKLNVYMTPPQVIIR
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEHHHHcccccccccccccccc
********IKALGQDRCQLADNLKETCFLIENTQGKILNVELLKWKREQQLQERRRLEAE**********HLYSHDPRALFKTIQACLTQEMRIVQQNDPHLYSHDPRALFKTIQACLTQEMRIVQQNDPVSNGARYNCTLDMIQGYCESLAEIIWMTRQQIKEAERLKNLISKYVDPPNMVDVLPNLNAQITQCLSHLVTSTFIIEKQPPQVMKTNTRFSATVRLLTGSKLNVYMTPPQV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQLLNTKIKALGQDRCQLADNLKETCFLIENTQGKILNxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKEHLYSHDPRALFKTIQACLTQEMRIVQQNDPHLYSHDPRALFKTIQACLTQEMRIVQQNDPVSNGARYNCTLDMIQGYCESLAEIIWMTRQQIKEAERLKNLISKYVDPPNMVDVLPNLNAQITQCLSHLVTSTFIIEKQPPQVMKTNTRFSATVRLLTGSKLNVYMTPPQVIIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal transducer and activator of transcription 5A Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.confidentQ95115
Signal transducer and activator of transcription 5A Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.confidentP42229
Signal transducer and activator of transcription 5B Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.confidentP52632

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000979 [MF]RNA polymerase II core promoter sequence-specific DNA bindingprobableGO:0044212, GO:0003676, GO:0043565, GO:0001067, GO:0000975, GO:0001012, GO:0000976, GO:0000977, GO:0001047, GO:0001046, GO:0003674, GO:0097159, GO:0003677, GO:1901363, GO:0005488
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:1901701 [BP]cellular response to oxygen-containing compoundprobableGO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032870 [BP]cellular response to hormone stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0009725, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0000981 [MF]sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y1U, chain A
Confidence level:very confident
Coverage over the Query: 2-52,132-243
View the alignment between query and template
View the model in PyMOL
Template: 1YVL, chain A
Confidence level:very confident
Coverage over the Query: 57-243
View the alignment between query and template
View the model in PyMOL