Diaphorina citri psyllid: psy15318

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------

MVFDACLKYNGAADMDNGMSYSNSYANNNTDSFSPDSPYFPFIMPPGRTVPPASIKRKRESIEPPENSDVDGAHGWYDEFGQASSPRFVSHKPNPSSIYTDPYYINNTGGGPGDPWAGGGPIQSPSPYADYSSPPEHAISTSNHLSQNLYPPSTLHLPPENMGYMSPSGGPADSSNISSITASPLPPMSTIRNPAAASGVQSPSLYPGHNSPIVQTTGPGPGDTVGKALASIYPADQSASSYSSNPSTPVSSPPPLSAQNSEWVSGPHASSPHFTSDHRGLHMSIPEQQRLDEAIGYLRSHTEGMEECLDDAINVIRNHADGQLNLPGLSHPSPGGSLLYHQHLGNSHAVSSTVGAIPAGYLAGLASSSDTDGHIKIENIANSSKKRKELTIDTKTESICSDQMNSVTSPTNSTSNKGSKRSRRYCSSADEDSEDPQTKAMREKERRQANNVRERIRIRDINEALKELGRMCMAHLKTDKPQTKLGILNMAVEVIMSLEQQVRERNLNPKAACLRRREEEKAEDSVGPKLGHHLSAVSQHMGIQPPSFPSMAPNAQGLMPQHDGPQ

ccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc

*VFDACLKY******************************************************************WY********************IYTDPYYINN******************************************************************************************************************************************************************************************AIGYLRSHTEGMEECLDDAINVIRNHADGQLN************LLYHQHLGNSHAVSSTV*****************************************************************************************************IRIRDINEALKELGRMCMAHLKTDKPQTKLGILNMAVEVIMSLEQQV****************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045666 [BP]	positive regulation of neuron differentiation	probable	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0070888 [MF]	E-box binding	probable	GO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5V, chain A
Confidence level:very confident
Coverage over the Query: 450-510
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 428-482,497-526
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1twf, chain A		probable	Alignment \| Template Structure