Diaphorina citri psyllid: psy15340


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MIPKLDWSAFYKATLMLGDAEISIPEKLIDSYEKDSEFLKKVHHALLEVEVVEGDLECPESGRKFPISSGIPNMLLKEDEI
ccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHEEccEEEcccccccccccccccccccccccc
MIPKLDWSAFYKATLMLGDAEISIPEKLIDSYEKDSEFLKKVHHALLEVEVVEGDLECPESGRKFPISSGIPNMLLK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPKLDWSAFYKATLMLGDAEISIPEKLIDSYEKDSEFLKKVHHALLEVEVVEGDLECPESGRKFPISSGIPNMLLKEDEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA methyltransferase 112 homolog Participates both in methylation of protein and tRNA species. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.confidentQ2KIA2
tRNA methyltransferase 112 homolog Participates both in methylation of protein and tRNA species. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.confidentQ9UI30
TRM112-like protein confidentQ9VP65

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008276 [MF]protein methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0018364 [BP]peptidyl-glutamine methylationprobableGO:0006479, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0008213, GO:0071704, GO:0043412, GO:0036211, GO:0043414, GO:0044237, GO:0008152, GO:0008150, GO:0032259
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J6A, chain A
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL