Diaphorina citri psyllid: psy15353


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MIHILVFLLGCTLVRGELYKFSDAYIDQINREANTWTAGRNFPANLSEEYLRQFLIADAKYFDQSDRPLPGDRKTYDPEYSATVPDRFDAREQWPNCGTIGHVPDTGACAAPHIFAAVGAFSDRRCIKSKGQQNRPLSTEYVASCCKICRYDDNKSCSHGSVFRTWNFLHKRGSVTGGDYGDRTGCQPSTISPCSHHGSAPTLPSCENQKVPKLKCHTRCTNPTYGRGFFQDKHRTTLTYWVDDNEDAIKKEILAHGPTTATFALYDDFYHYKSGVYKHTSNAKLENYLHSGKLIGWGTENGTPYWLVINTWGPHWGDRGTVKILRGKYECAFEYLIAAGKPKN
cHHHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEECcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHHcccEEEEEEEccccccccccEECcccccccccccEEEEEEEEcccccEEEEEEEccccccccccccEEEEcccccccccccEEEEcccc
MIHILVFLLGCTLVRGELYKFSDAYIDQINREANTWTAGRNFPANLSEEYLRQFLIADAK*********************ATVPDRFDAREQWPNCGTIGHVPDTGACAAPHIFAAVGAFSDRRCIKSKGQQNRPLSTEYVASCCKICRYDDNKSCSHGSVFRTWNFLHKRGSVTGGDYGDRTGCQPSTISPCSHHGSAPTLPSCENQKVPKLKCHTRCTNPTYGRGFFQDKHRTTLTYWVDDNEDAIKKEILAHGPTTATFALYDDFYHYKSGVYKHTSNAKLENYLHSGKLIGWGTENGTPYWLVINTWGPHWGDRGTVKILRGKYECAFEYLIAAGKPK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIHILVFLLGCTLVRGELYKFSDAYIDQINREANTWTAGRNFPANLSEEYLRQFLIADAKYFDQSDRPLPGDRKTYDPEYSATVPDRFDAREQWPNCGTIGHVPDTGACAAPHIFAAVGAFSDRRCIKSKGQQNRPLSTEYVASCCKICRYDDNKSCSHGSVFRTWNFLHKRGSVTGGDYGDRTGCQPSTISPCSHHGSAPTLPSCENQKVPKLKCHTRCTNPTYGRGFFQDKHRTTLTYWVDDNEDAIKKEILAHGPTTATFALYDDFYHYKSGVYKHTSNAKLENYLHSGKLIGWGTENGTPYWLVINTWGPHWGDRGTVKILRGKYECAFEYLIAAGKPKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.confidentP10605
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.confidentQ5R6D1
Cathepsin B-like cysteine proteinase 5 confidentP43509

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0060548 [BP]negative regulation of cell deathprobableGO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0004197 [MF]cysteine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0030984 [MF]kininogen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.22.-Cysteine endopeptidases.probable
3.4.22.1Transferred entry: 3.4.22.10.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CBJ, chain A
Confidence level:very confident
Coverage over the Query: 82-344
View the alignment between query and template
View the model in PyMOL
Template: 3HHI, chain A
Confidence level:very confident
Coverage over the Query: 65-343
View the alignment between query and template
View the model in PyMOL