Diaphorina citri psyllid: psy15360


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
ccccccEEEEEccHHHHHHHHHcccccEEEEcccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHHc
*NNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uroporphyrinogen decarboxylase (Fragment) Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.confidentP32362
Uroporphyrinogen decarboxylase Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.confidentQ5RDK5
Uroporphyrinogen decarboxylase Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.confidentP70697

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006779 [BP]porphyrin-containing compound biosynthetic processprobableGO:0006778, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0051188, GO:0071704, GO:0033014, GO:0033013, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0046502 [BP]uroporphyrinogen III metabolic processprobableGO:0044710, GO:0051186, GO:1901564, GO:0006082, GO:0044237, GO:0009987, GO:0006725, GO:0019752, GO:0071704, GO:0006807, GO:0033013, GO:0006778, GO:0008152, GO:0043436, GO:0008150, GO:0044281, GO:1901360, GO:0046483
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0008198 [MF]ferrous iron bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R3S, chain A
Confidence level:very confident
Coverage over the Query: 4-109
View the alignment between query and template
View the model in PyMOL