Psyllid ID: psy15360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
ccccccEEEEEccHHHHHHHHHcccccEEEEcccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHHc
ccccccEEEEEcccHHHHHHHccccccEEEEcccccHHHHHHHHcccEEEEEEcHHHHHccHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHc
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKnktlqgnldpcalyASKEKLRKIGTQMAKEFGKSRYIAnlghgiypdmdpEHVQVLIDAIHDAL
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKnktlqgnldPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
******MTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAI****
*NNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
**NDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNKTLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHDAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q8HY31367 Uroporphyrinogen decarbox N/A N/A 0.935 0.277 0.631 1e-35
P06132367 Uroporphyrinogen decarbox yes N/A 0.935 0.277 0.621 2e-35
Q5RDK5367 Uroporphyrinogen decarbox yes N/A 0.935 0.277 0.621 3e-35
P70697367 Uroporphyrinogen decarbox yes N/A 0.935 0.277 0.611 3e-34
P32362364 Uroporphyrinogen decarbox yes N/A 0.935 0.280 0.601 4e-34
Q9PTS2369 Uroporphyrinogen decarbox yes N/A 0.963 0.284 0.528 5e-31
Q2S1W0354 Uroporphyrinogen decarbox yes N/A 0.954 0.293 0.523 3e-28
Q9V595356 Uroporphyrinogen decarbox yes N/A 0.963 0.294 0.518 3e-27
O18601386 Uroporphyrinogen decarbox N/A N/A 0.944 0.266 0.480 1e-24
P32347362 Uroporphyrinogen decarbox yes N/A 0.935 0.281 0.476 1e-22
>sp|Q8HY31|DCUP_SHEEP Uroporphyrinogen decarboxylase OS=Ovis aries GN=UROD PE=1 SV=1 Back     alignment and function desciption
 Score =  148 bits (373), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%)

Query: 5   VPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASKE 63
           VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR  + K  TLQGNLDPCALYAS+E
Sbjct: 256 VPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPEKARERVGKTVTLQGNLDPCALYASEE 315

Query: 64  KLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIH 106
           ++ K+  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H
Sbjct: 316 EIGKLVQQMLNDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVH 358
Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.
Ovis aries (taxid: 9940)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7
>sp|P06132|DCUP_HUMAN Uroporphyrinogen decarboxylase OS=Homo sapiens GN=UROD PE=1 SV=2 Back     alignment and function description
>sp|Q5RDK5|DCUP_PONAB Uroporphyrinogen decarboxylase OS=Pongo abelii GN=UROD PE=2 SV=1 Back     alignment and function description
>sp|P70697|DCUP_MOUSE Uroporphyrinogen decarboxylase OS=Mus musculus GN=Urod PE=1 SV=2 Back     alignment and function description
>sp|P32362|DCUP_RAT Uroporphyrinogen decarboxylase (Fragment) OS=Rattus norvegicus GN=Urod PE=1 SV=1 Back     alignment and function description
>sp|Q9PTS2|DCUP_DANRE Uroporphyrinogen decarboxylase OS=Danio rerio GN=urod PE=2 SV=1 Back     alignment and function description
>sp|Q2S1W0|DCUP_SALRD Uroporphyrinogen decarboxylase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hemE PE=3 SV=1 Back     alignment and function description
>sp|Q9V595|DCUP_DROME Uroporphyrinogen decarboxylase OS=Drosophila melanogaster GN=Updo PE=3 SV=1 Back     alignment and function description
>sp|O18601|DCUP_DROVI Uroporphyrinogen decarboxylase OS=Drosophila virilis GN=Updo PE=3 SV=1 Back     alignment and function description
>sp|P32347|DCUP_YEAST Uroporphyrinogen decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
344287737 367 PREDICTED: uroporphyrinogen decarboxylas 0.935 0.277 0.631 8e-35
251836950 367 Chain A, Urod Mutant G318r 0.935 0.277 0.631 1e-34
354470142 367 PREDICTED: uroporphyrinogen decarboxylas 0.935 0.277 0.631 3e-34
351696842 367 Uroporphyrinogen decarboxylase [Heteroce 0.935 0.277 0.621 3e-34
402854333 367 PREDICTED: uroporphyrinogen decarboxylas 0.935 0.277 0.621 4e-34
355557945 367 hypothetical protein EGK_00693 [Macaca m 0.935 0.277 0.621 4e-34
297278556 367 PREDICTED: LOW QUALITY PROTEIN: uroporph 0.935 0.277 0.621 4e-34
329663263 367 uroporphyrinogen decarboxylase [Bos taur 0.935 0.277 0.631 4e-34
59891403 367 uroporphyrinogen decarboxylase [Ovis ari 0.935 0.277 0.631 4e-34
251836951 367 Chain A, Human Urod Mutant K297n 0.935 0.277 0.621 7e-34
>gi|344287737|ref|XP_003415609.1| PREDICTED: uroporphyrinogen decarboxylase-like [Loxodonta africana] Back     alignment and taxonomy information
 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 5   VPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASKE 63
           VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR ++ K  TLQGNLDPCALYAS+E
Sbjct: 256 VPMIIFAKDGHFALEELAQAGYEVVGLDWTLAPEKARELVGKTVTLQGNLDPCALYASEE 315

Query: 64  KLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIH 106
           ++R++  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H
Sbjct: 316 EIRQLVQQMLDDFGPRRYIANLGHGLYPDMDPEHVGAFVDAVH 358

Source: Loxodonta africana

Species: Loxodonta africana

Genus: Loxodonta

Family: Elephantidae

Order: Proboscidea

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|251836950|pdb|3GW0|A Chain A, Urod Mutant G318r Back     alignment and taxonomy information
>gi|354470142|ref|XP_003497428.1| PREDICTED: uroporphyrinogen decarboxylase [Cricetulus griseus] gi|344238500|gb|EGV94603.1| Uroporphyrinogen decarboxylase [Cricetulus griseus] Back     alignment and taxonomy information
>gi|351696842|gb|EHA99760.1| Uroporphyrinogen decarboxylase [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|402854333|ref|XP_003891828.1| PREDICTED: uroporphyrinogen decarboxylase [Papio anubis] Back     alignment and taxonomy information
>gi|355557945|gb|EHH14725.1| hypothetical protein EGK_00693 [Macaca mulatta] gi|380786243|gb|AFE64997.1| uroporphyrinogen decarboxylase [Macaca mulatta] gi|384942476|gb|AFI34843.1| uroporphyrinogen decarboxylase [Macaca mulatta] Back     alignment and taxonomy information
>gi|297278556|ref|XP_002808261.1| PREDICTED: LOW QUALITY PROTEIN: uroporphyrinogen decarboxylase-like [Macaca mulatta] Back     alignment and taxonomy information
>gi|329663263|ref|NP_001192487.1| uroporphyrinogen decarboxylase [Bos taurus] gi|296488965|tpg|DAA31078.1| TPA: uroporphyrinogen decarboxylase [Bos taurus] gi|440907290|gb|ELR57450.1| Uroporphyrinogen decarboxylase [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|59891403|ref|NP_001012341.1| uroporphyrinogen decarboxylase [Ovis aries] gi|75064956|sp|Q8HY31.1|DCUP_SHEEP RecName: Full=Uroporphyrinogen decarboxylase; Short=UPD; Short=URO-D gi|27527067|emb|CAC82649.1| uroporphyrinogen decarboxylase [Ovis aries] Back     alignment and taxonomy information
>gi|251836951|pdb|3GW3|A Chain A, Human Urod Mutant K297n Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
UNIPROTKB|E1BEX4367 UROD "Uncharacterized protein" 0.935 0.277 0.631 6.7e-33
UNIPROTKB|P06132367 UROD "Uroporphyrinogen decarbo 0.935 0.277 0.621 1.8e-32
UNIPROTKB|F1S365367 UROD "Uncharacterized protein" 0.935 0.277 0.621 1.8e-32
UNIPROTKB|E2RCH3367 UROD "Uncharacterized protein" 0.935 0.277 0.611 7.7e-32
UNIPROTKB|F1NBI2368 UROD "Uroporphyrinogen decarbo 0.935 0.277 0.601 1.3e-31
RGD|3946364 Urod "uroporphyrinogen decarbo 0.935 0.280 0.601 1.6e-31
UNIPROTKB|P32362364 Urod "Uroporphyrinogen decarbo 0.935 0.280 0.601 1.6e-31
MGI|MGI:98916367 Urod "uroporphyrinogen decarbo 0.935 0.277 0.611 2e-31
ZFIN|ZDB-GENE-000208-18402 urod "uroporphyrinogen decarbo 0.963 0.261 0.528 7.1e-29
FB|FBgn0033428356 Updo "Updo" [Drosophila melano 0.963 0.294 0.518 9.4e-27
UNIPROTKB|E1BEX4 UROD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 6.7e-33, P = 6.7e-33
 Identities = 65/103 (63%), Positives = 79/103 (76%)

Query:     5 VPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASKE 63
             VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR  + K  TLQGNLDPCALYAS+E
Sbjct:   256 VPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPEKARERVGKTVTLQGNLDPCALYASEE 315

Query:    64 KLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIH 106
             ++ K+  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H
Sbjct:   316 EIGKLVQQMLNDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVH 358
GO:0006782 "protoporphyrinogen IX biosynthetic process" evidence=IEA
GO:0015630 "microtubule cytoskeleton" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0004853 "uroporphyrinogen decarboxylase activity" evidence=IEA
UNIPROTKB|P06132 UROD "Uroporphyrinogen decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S365 UROD "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCH3 UROD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBI2 UROD "Uroporphyrinogen decarboxylase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3946 Urod "uroporphyrinogen decarboxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P32362 Urod "Uroporphyrinogen decarboxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:98916 Urod "uroporphyrinogen decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000208-18 urod "uroporphyrinogen decarboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0033428 Updo "Updo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V595DCUP_DROME4, ., 1, ., 1, ., 3, 70.51880.96330.2949yesN/A
Q2S1W0DCUP_SALRD4, ., 1, ., 1, ., 3, 70.52380.95410.2937yesN/A
Q5RDK5DCUP_PONAB4, ., 1, ., 1, ., 3, 70.62130.93570.2779yesN/A
P70697DCUP_MOUSE4, ., 1, ., 1, ., 3, 70.61160.93570.2779yesN/A
P06132DCUP_HUMAN4, ., 1, ., 1, ., 3, 70.62130.93570.2779yesN/A
Q9PTS2DCUP_DANRE4, ., 1, ., 1, ., 3, 70.52830.96330.2845yesN/A
P32362DCUP_RAT4, ., 1, ., 1, ., 3, 70.60190.93570.2802yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.1.37LOW CONFIDENCE prediction!
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd00717335 cd00717, URO-D, Uroporphyrinogen decarboxylase (UR 5e-45
TIGR01464338 TIGR01464, hemE, uroporphyrinogen decarboxylase 3e-40
PRK00115346 PRK00115, hemE, uroporphyrinogen decarboxylase; Va 3e-36
pfam01208338 pfam01208, URO-D, Uroporphyrinogen decarboxylase ( 2e-32
PLN02433345 PLN02433, PLN02433, uroporphyrinogen decarboxylase 1e-28
COG0407352 COG0407, HemE, Uroporphyrinogen-III decarboxylase 3e-28
cd00465306 cd00465, URO-D_CIMS_like, The URO-D_CIMS_like prot 4e-18
cd03465330 cd03465, URO-D_like, The URO-D _like protein super 3e-12
>gnl|CDD|238368 cd00717, URO-D, Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors Back     alignment and domain information 
 Score =  148 bits (375), Expect = 5e-45
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 3   NDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYAS 61
             VP+ +FAKGA   LE+L Q   D+VG+DW ++   AR  +     LQGNLDP  LYA 
Sbjct: 229 PGVPVILFAKGAGGLLEDLAQLGADVVGLDWRVDLDEARKRLGPKVALQGNLDPALLYAP 288

Query: 62  KEKLRKIGTQMAKEFG-KSRYIANLGHGIYPDMDPEHVQVLIDAIH 106
           KE + K   ++ K FG    +I NLGHGI PD  PE+V+ L++A+H
Sbjct: 289 KEAIEKEVKRILKAFGGAPGHIFNLGHGILPDTPPENVKALVEAVH 334

This reaction is located at the branching point of the tetrapyrrole biosynthetic pathway, leading to the biosynthesis of heme, chlorophyll or bacteriochlorophyll. URO-D deficiency is responsible for the human genetic diseases familial porphyria cutanea tarda (fPCT) and hepatoerythropoietic porphyria (HEP). Length = 335
>gnl|CDD|233423 TIGR01464, hemE, uroporphyrinogen decarboxylase Back     alignment and domain information
>gnl|CDD|234644 PRK00115, hemE, uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|216366 pfam01208, URO-D, Uroporphyrinogen decarboxylase (URO-D) Back     alignment and domain information
>gnl|CDD|215237 PLN02433, PLN02433, uroporphyrinogen decarboxylase Back     alignment and domain information
>gnl|CDD|223484 COG0407, HemE, Uroporphyrinogen-III decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238261 cd00465, URO-D_CIMS_like, The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases Back     alignment and domain information
>gnl|CDD|239548 cd03465, URO-D_like, The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
PLN02433345 uroporphyrinogen decarboxylase 100.0
COG0407352 HemE Uroporphyrinogen-III decarboxylase [Coenzyme 100.0
PRK00115346 hemE uroporphyrinogen decarboxylase; Validated 99.98
TIGR01464338 hemE uroporphyrinogen decarboxylase. This model re 99.97
cd00717335 URO-D Uroporphyrinogen decarboxylase (URO-D) is a 99.97
KOG2872|consensus359 99.97
PF01208343 URO-D: Uroporphyrinogen decarboxylase (URO-D); Int 99.96
cd03308378 CmuA_CmuC_like CmuA_CmuC_like: uncharacterized pro 99.95
TIGR01463340 mtaA_cmuA methyltransferase, MtaA/CmuA family. Thi 99.95
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al 99.95
cd03465330 URO-D_like The URO-D _like protein superfamily inc 99.95
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Vali 99.95
cd00465306 URO-D_CIMS_like The URO-D_CIMS_like protein superf 99.92
cd03309321 CmuC_like CmuC_like. Proteins similar to the putat 99.89
PRK04326330 methionine synthase; Provisional 99.59
PRK00957305 methionine synthase; Provisional 99.56
cd03311332 CIMS_C_terminal_like CIMS - Cobalamine-independent 99.12
PRK09121339 5-methyltetrahydropteroyltriglutamate--homocystein 98.18
PF01717324 Meth_synt_2: Cobalamin-independent synthase, Catal 98.06
PRK01207343 methionine synthase; Provisional 97.9
PRK08575326 5-methyltetrahydropteroyltriglutamate--homocystein 97.87
PRK06233372 hypothetical protein; Provisional 97.72
PLN02475766 5-methyltetrahydropteroyltriglutamate--homocystein 97.46
PRK06520368 5-methyltetrahydropteroyltriglutamate--homocystein 97.44
PRK05222758 5-methyltetrahydropteroyltriglutamate--homocystein 97.44
TIGR01371750 met_syn_B12ind 5-methyltetrahydropteroyltriglutama 97.03
cd03310321 CIMS_like CIMS - Cobalamine-independent methonine 96.8
cd03312360 CIMS_N_terminal_like CIMS - Cobalamine-independent 96.79
PRK06052344 5-methyltetrahydropteroyltriglutamate--homocystein 96.72
PLN02475 766 5-methyltetrahydropteroyltriglutamate--homocystein 95.76
TIGR01371 750 met_syn_B12ind 5-methyltetrahydropteroyltriglutama 95.64
COG0620330 MetE Methionine synthase II (cobalamin-independent 95.57
KOG2263|consensus765 94.99
PRK05222 758 5-methyltetrahydropteroyltriglutamate--homocystein 94.87
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 93.09
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 92.09
cd07939 259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 91.77
cd07948 262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 91.63
cd07940 268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 91.26
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 89.5
KOG4828|consensus125 89.3
TIGR03234 254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 88.55
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 88.22
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 87.76
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 87.68
cd01096315 Alkanal_monooxygenase Alkanal monooxygenase are fl 86.46
PRK10508333 hypothetical protein; Provisional 85.97
PF1017890 DUF2372: Uncharacterised conserved protein (DUF237 85.51
PRK09389 488 (R)-citramalate synthase; Provisional 84.72
PLN02746 347 hydroxymethylglutaryl-CoA lyase 84.04
PRK09856 275 fructoselysine 3-epimerase; Provisional 83.8
PRK09989 258 hypothetical protein; Provisional 81.98
PF00682237 HMGL-like: HMGL-like of this family is not conserv 81.84
PLN02274 505 inosine-5'-monophosphate dehydrogenase 81.24
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 80.34
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information 
Probab=100.00  E-value=3.4e-33  Score=214.11  Aligned_cols=106  Identities=35%  Similarity=0.596  Sum_probs=101.5

Q ss_pred             CCcEEEeecchhhhHHHHhccCCceEeeecccChhhHhhhhcCC-ccccCCCcccccccHHHHHHHHHHHHHHhccccch
Q psy15360          4 DVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNK-TLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRYI   82 (109)
Q Consensus         4 ~~pvi~~~~g~~~~l~~l~~~g~d~~~id~~~d~~~~~~~~g~~-~l~GNidp~~L~gt~e~i~~~~~~~l~~~~~~g~I   82 (109)
                      ++|+|+|+||...+++.+.++|++++|+||.+|++++++.+|++ +||||+||.+|+||+|+|+++++++|+.++++|||
T Consensus       232 ~~~~ilh~cG~~~~~~~~~~~~~~~i~~d~~~dl~e~~~~~g~~~~l~GNi~p~ll~gt~e~i~~~v~~~i~~~~~~g~I  311 (345)
T PLN02433        232 DVPLILYANGSGGLLERLAGTGVDVIGLDWTVDMADARRRLGSDVAVQGNVDPAVLFGSKEAIEKEVRDVVKKAGPQGHI  311 (345)
T ss_pred             CCCEEEEeCCCHHHHHHHHhcCCCEEEcCCCCCHHHHHHHhCCCeEEEeCCCchhhCCCHHHHHHHHHHHHHHcCCCCeE
Confidence            57999999998899999999999999999999999999999999 99999999877899999999999999997767799


Q ss_pred             hccCCccCCCCChHHHHHHHHHhhhhC
Q psy15360         83 ANLGHGIYPDMDPEHVQVLIDAIHDAL  109 (109)
Q Consensus        83 l~~gcgi~~~tp~eNi~a~v~a~~~~~  109 (109)
                      ||+||+|+|+||+|||+||++++|+|+
T Consensus       312 l~~Gc~i~~~tp~eNi~a~v~av~~~~  338 (345)
T PLN02433        312 LNLGHGVLVGTPEENVAHFFDVARELR  338 (345)
T ss_pred             EecCCCCCCCCCHHHHHHHHHHHHHhC
Confidence            999999999999999999999999986

>COG0407 HemE Uroporphyrinogen-III decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>TIGR01464 hemE uroporphyrinogen decarboxylase Back     alignment and domain information
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors Back     alignment and domain information
>KOG2872|consensus Back     alignment and domain information
>PF01208 URO-D: Uroporphyrinogen decarboxylase (URO-D); InterPro: IPR000257 Uroporphyrinogen decarboxylase (URO-D), the fifth enzyme of the haem biosynthetic pathway, catalyses the sequential decarboxylation of the four acetyl side chains of uroporphyrinogen to yield coproporphyrinogen [] Back     alignment and domain information
>cd03308 CmuA_CmuC_like CmuA_CmuC_like: uncharacterized protein family similar to uroporphyrinogen decarboxylase (URO-D) and the methyltransferases CmuA and CmuC Back     alignment and domain information
>TIGR01463 mtaA_cmuA methyltransferase, MtaA/CmuA family Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>cd00465 URO-D_CIMS_like The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases Back     alignment and domain information
>cd03309 CmuC_like CmuC_like Back     alignment and domain information
>PRK04326 methionine synthase; Provisional Back     alignment and domain information
>PRK00957 methionine synthase; Provisional Back     alignment and domain information
>cd03311 CIMS_C_terminal_like CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like Back     alignment and domain information
>PRK09121 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PF01717 Meth_synt_2: Cobalamin-independent synthase, Catalytic domain; InterPro: IPR002629 This is a domain of vitamin-B12 independent methionine synthases or 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferases, 2 Back     alignment and domain information
>PRK01207 methionine synthase; Provisional Back     alignment and domain information
>PRK08575 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK06233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02475 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase Back     alignment and domain information
>PRK06520 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK05222 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional Back     alignment and domain information
>TIGR01371 met_syn_B12ind 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase Back     alignment and domain information
>cd03310 CIMS_like CIMS - Cobalamine-independent methonine synthase, or MetE Back     alignment and domain information
>cd03312 CIMS_N_terminal_like CIMS - Cobalamine-independent methonine synthase, or MetE, N-terminal domain_like Back     alignment and domain information
>PRK06052 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>PLN02475 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase Back     alignment and domain information
>TIGR01371 met_syn_B12ind 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase Back     alignment and domain information
>COG0620 MetE Methionine synthase II (cobalamin-independent) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2263|consensus Back     alignment and domain information
>PRK05222 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>KOG4828|consensus Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>cd01096 Alkanal_monooxygenase Alkanal monooxygenase are flavin monoxygenases Back     alignment and domain information
>PRK10508 hypothetical protein; Provisional Back     alignment and domain information
>PF10178 DUF2372: Uncharacterised conserved protein (DUF2372); InterPro: IPR018788 Proteasome assembly chaperone 3 (PSMG3) promotes assembly of the 20S proteasome [] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3gw0_A367 Urod Mutant G318r Length = 367 2e-37
3gw3_A367 Human Urod Mutant K297n Length = 367 1e-36
1r3w_A367 Uroporphyrinogen Decarboxylase Y164f Mutant In Comp 2e-36
1r3s_A367 Uroporphyrinogen Decarboxylase Single Mutant D86g I 2e-36
2q71_A356 Uroporphyrinogen Decarboxylase G168r Single Mutant 2e-36
1r3v_A367 Uroporphyrinogen Decarboxylase Single Mutant D86e I 2e-36
1r3r_A367 Uroporphyrinogen Decarboxylase With Mutation D86n L 2e-36
1uro_A367 Uroporphyrinogen Decarboxylase Length = 367 2e-36
3gvv_A367 Single-Chain Urod Y164g (Gy) Mutation Length = 367 2e-36
1jpi_A388 Phe232leu Mutant Of Human Urod, Human Uroporphyrino 2e-36
1jpk_A388 Gly156asp Mutant Of Human Urod, Human Uroporphyrino 2e-36
1jph_A388 Ile260thr Mutant Of Human Urod, Human Uroporphyrino 8e-36
3cyv_A354 Crystal Structure Of Uroporphyrinogen Decarboxylase 1e-17
4exq_A368 Crystal Structure Of Uroporphyrinogen Decarboxylase 3e-15
2inf_A359 Crystal Structure Of Uroporphyrinogen Decarboxylase 3e-13
2eja_A338 Crystal Structure Of Uroporphyrinogen Decarboxylase 5e-13
1j93_A353 Crystal Structure And Substrate Binding Modeling Of 6e-12
>pdb|3GW0|A Chain A, Urod Mutant G318r Length = 367 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (378), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 80/103 (77%), Gaps = 1/103 (0%)
Query: 5   VPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASKE 63
           VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR  + K  TLQGNLDPCALYAS+E
Sbjct: 256 VPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEE 315
Query: 64  KLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIH 106
           ++R++  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H
Sbjct: 316 EIRQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVH 358
>pdb|3GW3|A Chain A, Human Urod Mutant K297n Length = 367 Back     alignment and structure
>pdb|1R3W|A Chain A, Uroporphyrinogen Decarboxylase Y164f Mutant In Complex With Coproporphyrinogen-Iii Length = 367 Back     alignment and structure
>pdb|1R3S|A Chain A, Uroporphyrinogen Decarboxylase Single Mutant D86g In Complex With Coproporphyrinogen-I Length = 367 Back     alignment and structure
>pdb|2Q71|A Chain A, Uroporphyrinogen Decarboxylase G168r Single Mutant Enzyme In Complex With Coproporphyrinogen-Iii Length = 356 Back     alignment and structure
>pdb|1R3V|A Chain A, Uroporphyrinogen Decarboxylase Single Mutant D86e In Complex With Coproporphyrinogen-I Length = 367 Back     alignment and structure
>pdb|1R3R|A Chain A, Uroporphyrinogen Decarboxylase With Mutation D86n Length = 367 Back     alignment and structure
>pdb|1URO|A Chain A, Uroporphyrinogen Decarboxylase Length = 367 Back     alignment and structure
>pdb|3GVV|A Chain A, Single-Chain Urod Y164g (Gy) Mutation Length = 367 Back     alignment and structure
>pdb|1JPI|A Chain A, Phe232leu Mutant Of Human Urod, Human Uroporphyrinogen Iii Decarboxylase Length = 388 Back     alignment and structure
>pdb|1JPK|A Chain A, Gly156asp Mutant Of Human Urod, Human Uroporphyrinogen Iii Decarboxylase Length = 388 Back     alignment and structure
>pdb|1JPH|A Chain A, Ile260thr Mutant Of Human Urod, Human Uroporphyrinogen Iii Decarboxylase Length = 388 Back     alignment and structure
>pdb|3CYV|A Chain A, Crystal Structure Of Uroporphyrinogen Decarboxylase From Shigella Flexineri: New Insights Into Its Catalytic Mechanism Length = 354 Back     alignment and structure
>pdb|4EXQ|A Chain A, Crystal Structure Of Uroporphyrinogen Decarboxylase (Upd) From Burkholderia Thailandensis E264 Length = 368 Back     alignment and structure
>pdb|2INF|A Chain A, Crystal Structure Of Uroporphyrinogen Decarboxylase From Bacillus Subtilis Length = 359 Back     alignment and structure
>pdb|2EJA|A Chain A, Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex Aeolicus Length = 338 Back     alignment and structure
>pdb|1J93|A Chain A, Crystal Structure And Substrate Binding Modeling Of The Uroporphyrinogen-Iii Decarboxylase From Nicotiana Tabacum: Implications For The Catalytic Mechanism Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1r3s_A367 URO-D, uroporphyrinogen decarboxylase, UPD; uropor 4e-50
1j93_A353 UROD, uroporphyrinogen decarboxylase; beta barrel, 3e-49
2inf_A359 URO-D, UPD, uroporphyrinogen decarboxylase; (alpha 3e-48
3cyv_A354 URO-D, UPD, uroporphyrinogen decarboxylase; alpha/ 7e-48
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 2e-47
4exq_A368 UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid 3e-47
>1r3s_A URO-D, uroporphyrinogen decarboxylase, UPD; uroporphyrinogen decarboxylase coproporphyrinogen, X-RAY crystallography, lyase; HET: 1CP; 1.65A {Homo sapiens} SCOP: c.1.22.1 PDB: 1r3t_A* 1r3r_A 1r3q_A* 1r3y_A* 1uro_A 3gvq_A 3gvr_A 1r3v_A* 3gvv_A 3gvw_A 1jph_A 1r3w_A* 3gw3_A 1jpi_A 1jpk_A 3gw0_A 2q71_A* 2q6z_A* Length = 367 Back     alignment and structure
 Score =  161 bits (409), Expect = 4e-50
 Identities = 64/105 (60%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 4   DVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASK 62
            VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR  + K  TLQGNLDPCALYAS+
Sbjct: 255 PVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASE 314

Query: 63  EKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHD 107
           E++ ++  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H 
Sbjct: 315 EEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHK 359
>1j93_A UROD, uroporphyrinogen decarboxylase; beta barrel, plastidial enzyme, crystallographic dimer, lyase; 2.30A {Nicotiana tabacum} SCOP: c.1.22.1 Length = 353 Back     alignment and structure
>2inf_A URO-D, UPD, uroporphyrinogen decarboxylase; (alpha-beta)8 barrel, eight parallel beta strands surrounded by eight alpha helices, lyase; 2.30A {Bacillus subtilis} Length = 359 Back     alignment and structure
>3cyv_A URO-D, UPD, uroporphyrinogen decarboxylase; alpha/beta barrel, cytoplasm, lyase, porphyrin biosynthesis; 2.80A {Shigella flexneri} Length = 354 Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Length = 338 Back     alignment and structure
>4exq_A UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid, NIH, SBRI, heme biosynthesis, structural GENO niaid; 1.65A {Burkholderia thailandensis} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
4exq_A368 UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid 100.0
1r3s_A367 URO-D, uroporphyrinogen decarboxylase, UPD; uropor 99.98
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 99.97
3cyv_A354 URO-D, UPD, uroporphyrinogen decarboxylase; alpha/ 99.97
1j93_A353 UROD, uroporphyrinogen decarboxylase; beta barrel, 99.97
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 99.97
2inf_A359 URO-D, UPD, uroporphyrinogen decarboxylase; (alpha 99.96
1u1j_A765 5-methyltetrahydropteroyltriglutamate-- homocystei 99.23
2nq5_A755 5-methyltetrahydropteroyltriglutamate-- homocystei 99.16
1ypx_A375 Putative vitamin-B12 independent methionine synth 99.1
3rpd_A357 Methionine synthase (B12-independent); structural 99.07
1t7l_A766 5-methyltetrahydropteroyltriglutamate-- homocystei 98.64
1u1j_A 765 5-methyltetrahydropteroyltriglutamate-- homocystei 98.44
3ppg_A789 5-methyltetrahydropteroyltriglutamate--homocystei 98.1
2nq5_A 755 5-methyltetrahydropteroyltriglutamate-- homocystei 98.07
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 91.58
2ftp_A 302 Hydroxymethylglutaryl-COA lyase; structural genomi 88.95
3ppg_A 789 5-methyltetrahydropteroyltriglutamate--homocystei 88.92
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 88.17
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 86.45
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 86.02
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 85.7
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 85.67
3vnd_A 267 TSA, tryptophan synthase alpha chain; psychrophili 85.09
2cw6_A 298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 84.42
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 84.35
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 83.19
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 82.92
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 82.71
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 82.02
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 81.76
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 81.39
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 80.88
1ydo_A 307 HMG-COA lyase; TIM-barrel protein, structural geno 80.88
>4exq_A UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid, NIH, SBRI, heme biosynthesis, structural GENO niaid; 1.65A {Burkholderia thailandensis} Back     alignment and structure
Probab=100.00  E-value=7.2e-34  Score=218.44  Aligned_cols=106  Identities=40%  Similarity=0.651  Sum_probs=102.1

Q ss_pred             CCcEEEeecchhhhHHHHhccCCceEeeecccChhhHhhhhcCC-ccccCCCcccccccHHHHHHHHHHHHHHhcc-ccc
Q psy15360          4 DVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNK-TLQGNLDPCALYASKEKLRKIGTQMAKEFGK-SRY   81 (109)
Q Consensus         4 ~~pvi~~~~g~~~~l~~l~~~g~d~~~id~~~d~~~~~~~~g~~-~l~GNidp~~L~gt~e~i~~~~~~~l~~~~~-~g~   81 (109)
                      ++|+||||||+..+++.+.++|+|++++||.+|++++++.+|++ +||||+||.+|+||+|+|+++++++|+.+++ +||
T Consensus       252 ~~pvi~f~~g~~~~l~~l~~~g~d~i~~d~~~dl~~ak~~~g~~~~l~Gnldp~~L~gt~e~I~~~v~~~l~~~g~~~g~  331 (368)
T 4exq_A          252 RVPAIAFTKGGGLWLEDLAATGVDAVGLDWTVNLGRARERVAGRVALQGNLDPTILFAPPEAIRAEARAVLDSYGNHPGH  331 (368)
T ss_dssp             ECCEEEEETTCGGGHHHHHTSSCSEEECCTTSCHHHHHHHHTTSSEEEEEECGGGGGSCHHHHHHHHHHHHHHHCSCSCE
T ss_pred             CCcEEEEcCCcHHHHHHHHHhCCCEEeeCCCCCHHHHHHHhCCCEEEEECCCHHHhCCCHHHHHHHHHHHHHHhCCCCCE
Confidence            58999999999889999999999999999999999999999999 9999999998899999999999999999885 899


Q ss_pred             hhccCCccCCCCChHHHHHHHHHhhhhC
Q psy15360         82 IANLGHGIYPDMDPEHVQVLIDAIHDAL  109 (109)
Q Consensus        82 Il~~gcgi~~~tp~eNi~a~v~a~~~~~  109 (109)
                      |||+||+|+|+||+||++||++++|+||
T Consensus       332 I~n~Ghgi~p~tp~Env~a~veav~~~~  359 (368)
T 4exq_A          332 VFNLGHGISQFTPPEHVAELVDEVHRHS  359 (368)
T ss_dssp             EEEESSCCCTTCCHHHHHHHHHHHHHHH
T ss_pred             EEeCCCCCCCCcCHHHHHHHHHHHHHhC
Confidence            9999999999999999999999999985
>1r3s_A URO-D, uroporphyrinogen decarboxylase, UPD; uroporphyrinogen decarboxylase coproporphyrinogen, X-RAY crystallography, lyase; HET: 1CP; 1.65A {Homo sapiens} SCOP: c.1.22.1 PDB: 1r3t_A* 1r3r_A 1r3q_A* 1r3y_A* 1uro_A 3gvq_A 3gvr_A 1r3v_A* 3gvv_A 3gvw_A 1jph_A 1r3w_A* 3gw3_A 1jpi_A 1jpk_A 3gw0_A 2q71_A* 2q6z_A* Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cyv_A URO-D, UPD, uroporphyrinogen decarboxylase; alpha/beta barrel, cytoplasm, lyase, porphyrin biosynthesis; 2.80A {Shigella flexneri} Back     alignment and structure
>1j93_A UROD, uroporphyrinogen decarboxylase; beta barrel, plastidial enzyme, crystallographic dimer, lyase; 2.30A {Nicotiana tabacum} SCOP: c.1.22.1 Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>2inf_A URO-D, UPD, uroporphyrinogen decarboxylase; (alpha-beta)8 barrel, eight parallel beta strands surrounded by eight alpha helices, lyase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1u1j_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; methionine, synthase, methyltetrahydrofolate; HET: C2F; 2.40A {Arabidopsis thaliana} SCOP: c.1.22.2 c.1.22.2 PDB: 1u1h_A* 1u1u_A 1u22_A* Back     alignment and structure
>2nq5_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; structural genomics, target 6426D, PSI; 1.90A {Streptococcus mutans} PDB: 3l7s_A 3l7r_A 3t0c_A Back     alignment and structure
>1ypx_A Putative vitamin-B12 independent methionine synth protein; alpha-beta protein; 2.60A {Listeria monocytogenes} Back     alignment and structure
>3rpd_A Methionine synthase (B12-independent); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, rossmann fold, Zn, TRA; HET: MSE; 1.50A {Shewanella SP} Back     alignment and structure
>1t7l_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; TIM barrel, methyltetrahydrofolate, zinc; 2.00A {Thermotoga maritima} PDB: 3bq5_A 3bq6_A 1xdj_A 1xr2_A* 1xpg_A* Back     alignment and structure
>1u1j_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; methionine, synthase, methyltetrahydrofolate; HET: C2F; 2.40A {Arabidopsis thaliana} SCOP: c.1.22.2 c.1.22.2 PDB: 1u1h_A* 1u1u_A 1u22_A* Back     alignment and structure
>3ppg_A 5-methyltetrahydropteroyltriglutamate--homocystei methyltransferase; cobalamin-independent, surface entropy reduction; 1.98A {Candida albicans} PDB: 3ppf_A 3pph_A 3ppc_A Back     alignment and structure
>2nq5_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; structural genomics, target 6426D, PSI; 1.90A {Streptococcus mutans} PDB: 3l7s_A 3l7r_A 3t0c_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3ppg_A 5-methyltetrahydropteroyltriglutamate--homocystei methyltransferase; cobalamin-independent, surface entropy reduction; 1.98A {Candida albicans} PDB: 3ppf_A 3pph_A 3ppc_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1r3sa_356 c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD 3e-24
d1j93a_343 c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD 8e-23
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Length = 356 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: UROD/MetE-like
family: Uroporphyrinogen decarboxylase, UROD
domain: Uroporphyrinogen decarboxylase, UROD
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.3 bits (228), Expect = 3e-24
 Identities = 64/105 (60%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 4   DVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSII-KNKTLQGNLDPCALYASK 62
            VPM IFAK  H+ALEEL Q  Y++VG+DWT+ P  AR  + K  TLQGNLDPCALYAS+
Sbjct: 245 PVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASE 304

Query: 63  EKLRKIGTQMAKEFGKSRYIANLGHGIYPDMDPEHVQVLIDAIHD 107
           E++ ++  QM  +FG  RYIANLGHG+YPDMDPEHV   +DA+H 
Sbjct: 305 EEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHK 349
>d1j93a_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]} Length = 343 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1j93a_343 Uroporphyrinogen decarboxylase, UROD {Tobacco (Nic 100.0
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 99.97
d1u1ha2365 5-methyltetrahydropteroyltriglutamate--homocystein 98.09
d1u1ha1394 5-methyltetrahydropteroyltriglutamate--homocystein 94.54
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 91.86
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.77
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 91.55
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 90.71
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.67
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 89.66
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 89.42
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 89.26
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 88.48
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.03
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 87.77
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 87.4
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 87.1
d1luca_355 Bacterial luciferase alpha chain, LuxA {Vibrio har 85.64
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 85.28
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 85.27
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 85.08
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 84.61
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 84.37
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 84.31
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 83.94
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 83.61
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 83.58
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 83.45
d2q02a1 271 Putative cytoplasmic protein STM4435 {Salmonella t 83.44
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 83.36
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 83.32
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 82.97
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 82.84
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 82.54
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.69
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 81.63
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 81.36
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 81.34
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 81.25
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 80.67
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 80.26
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 80.16
>d1j93a_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: UROD/MetE-like
family: Uroporphyrinogen decarboxylase, UROD
domain: Uroporphyrinogen decarboxylase, UROD
species: Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]

Probab=100.00  E-value=3.3e-33  Score=210.25  Aligned_cols=107  Identities=31%  Similarity=0.503  Sum_probs=102.1

Q ss_pred             CCCcEEEeecchhhhHHHHhccCCceEeeecccChhhHhhhhcCC-ccccCCCcccccccHHHHHHHHHHHHHHhccccc
Q psy15360          3 NDVPMTIFAKGAHYALEELNQTKYDIVGIDWTIEPSLARSIIKNK-TLQGNLDPCALYASKEKLRKIGTQMAKEFGKSRY   81 (109)
Q Consensus         3 ~~~pvi~~~~g~~~~l~~l~~~g~d~~~id~~~d~~~~~~~~g~~-~l~GNidp~~L~gt~e~i~~~~~~~l~~~~~~g~   81 (109)
                      .++|++||++++...++.+.++|++++|+||.+|+.+|++.++++ +|||||||.+|+|++|+|+++++++++.+++++|
T Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~is~d~~~~l~~a~~~~~~~~~iqGNldP~~L~~~~e~i~~~~~~~l~~~~~~~~  314 (343)
T d1j93a_         235 PNLPLILYASGSGGLLERLPLTGVDVVSLDWTVDMADGRRRLGPNVAIQGNVDPGVLFGSKEFITNRINDTVKKAGKGKH  314 (343)
T ss_dssp             TTCCEEEECSSCTTTGGGGGGGCCSEEECCTTSCHHHHHHHTCSSSEEECCBCGGGGGSCHHHHHHHHHHHHHHHCSSSE
T ss_pred             CCCceeeecccccchhhhhhccCccccccccccchHHHHHHhCCCeEEEeCCChHHHcCCHHHHHHHHHHHHHhcCCCCc
Confidence            468899999998888999999999999999999999999999999 9999999998899999999999999999988889


Q ss_pred             hhccCCccCCCCChHHHHHHHHHhhhhC
Q psy15360         82 IANLGHGIYPDMDPEHVQVLIDAIHDAL  109 (109)
Q Consensus        82 Il~~gcgi~~~tp~eNi~a~v~a~~~~~  109 (109)
                      |||+||||+|+||+|||+|||+++|+|+
T Consensus       315 I~~lGhgi~~~Tp~eNv~a~v~~vr~~~  342 (343)
T d1j93a_         315 ILNLGHGIKVGTPEENFAHFFEIAKGLR  342 (343)
T ss_dssp             EBCBSSCCCTTCCHHHHHHHHHHHHTCC
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999985
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u1ha1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure