Diaphorina citri psyllid: psy15388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MFLLTMIARVRDGLILSASMQDDEYSERSTLEYQNQAKQLFRKLNLNSPAKLSIETGNYFFHYLIDRGVCFLALCEKTFSTKVAYSYLESLSLEFHGQYGGQFEQCTRPYAFVEFDSSIKKLRKSFTDTRVRRNLNTLNTELQDVQRIMVQNIDDINATMNLVLGLGNQIDLTGIPDQVRLLGLPDKHTLSGIPDQVRLFIGLPDEHTLSGRPDRYT
ccEEEEEEEEEccEEEEEECcccccccHHHHHHHHHHHHHHHHHcccccccEEEECccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccHHHHHHccccEEEEEEEECcccccccccccccc
MFLLTMIARVRDGLILSASMQDDEYSERSTLEYQNQAKQLFRKLNLNSPAKLSIETGNYFFHYLIDRGVCFLALCEKTFSTKVAYSYLESLSLEFHGQYGGQFEQCTRPYAFVEFDSSIKKLRKSFTDTRVRRNLNTLNTELQDVQRIMVQNIDDINATMNLVLGLGNQIDLTGIPDQVRLLGLPDKHTLSGIPDQVRLFIGLPDEHTL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLLTMIARVRDGLILSASMQDDEYSERSTLEYQNQAKQLFRKLNLNSPAKLSIETGNYFFHYLIDRGVCFLALCEKTFSTKVAYSYLESLSLEFHGQYGGQFEQCTRPYAFVEFDSSIKKLRKSFTDTRVRRNLNTLNTELQDVQRIMVQNIDDINATMNLVLGLGNQIDLTGIPDQVRLLGLPDKHTLSGIPDQVRLFIGLPDEHTLSGRPDRYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-trafficking protein SEC22b SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.confidentO08595
Vesicle-trafficking protein SEC22b SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.confidentQ5RAI9
Vesicle-trafficking protein SEC22b SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.confidentQ4KM74

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006906 [BP]vesicle fusionprobableGO:0006996, GO:0009987, GO:0016192, GO:0008150, GO:0016044, GO:0071840, GO:0006810, GO:0016050, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016043
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005484 [MF]SNAP receptor activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0012507 [CC]ER to Golgi transport vesicle membraneprobableGO:0043226, GO:0043229, GO:0030133, GO:0030135, GO:0030134, GO:0005737, GO:0005575, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030658, GO:0030659, GO:0012505, GO:0012506, GO:0031090, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0033116 [CC]endoplasmic reticulum-Golgi intermediate compartment membraneprobableGO:0005737, GO:0031090, GO:0005793, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NUT, chain C
Confidence level:very confident
Coverage over the Query: 1-129,147-157
View the alignment between query and template
View the model in PyMOL