Diaphorina citri psyllid: psy15404


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
AEIQQEAELRLASKKIRSEQERELKEFRESQKQEMRLLKQEVDLMPKDRRKSMFKDRKEKLETEHEERRQIHERQQHAKKQLKDGFFLQRHQMLIRHDKELEQLKRMNQRKIEELTKKQTIEKRALPKRIRSEMKIREQMFRQSMRISSSSTPDPEVEREKLKKFQETEKKRYRAETQRFELKHQKQLEELKAQCETNIKELEQLQNEKRKMLMEHENMKLKEQEEFYSKELKEWKAQLKPRKQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
*************************************************************************************FFLQRHQMLI**********************************************************************************************************************************************QL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AEIQQEAELRLASKKIRSEQxxxxxxxxxxxxxxxxxxxxxVDLMPKDRRKSMFKDRKEKLETEHEERRQIHERQQHAKKQLKDGFFLQRHQMxxxxxxxxxxxxxxxxxxxxxxxxxQTIEKRALPKRIRSEMKIREQMFRQSMRISSSSTPDPEVEREKLKKFQETEKKRYRAETQRFELKHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKPRKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
STE20-like serine/threonine-protein kinase Mediates apoptosis and actin stress fiber dissolution.confidentO55092
STE20-like serine/threonine-protein kinase Mediates apoptosis and actin stress fiber dissolution.confidentQ9H2G2
STE20-like serine/threonine-protein kinase Mediates apoptosis and actin stress fiber dissolution.confidentO54988

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JAD, chain A
Confidence level:probable
Coverage over the Query: 182-236
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 2-78
View the alignment between query and template
View the model in PyMOL