Diaphorina citri psyllid: psy15407


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600----
NGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGVEEFRTRYAGDCLIDAACPSGCSCDGTRVDCSQRGLKEIPKDIPLYTTELILNDNEIGKIKSDGLFGRLPNLIKLDLRRNQVTGIEDNAFEGENDQGCLGDNYCPPKCTCTVRVLFYDGRAGECYIAVELFSSRIRVSYYVGNYPVSTMYRDLSNNQIGFLSNFTFSPLSKLSQLILSYNKLQCIDRDALAGLKSLRIISLHGNDISMIPEGAFADLHAITHLAIGGNPLYCDCGLAWLSEWVKRDYVEPGIARCTEPASMRDKLLLTAPASSFQCKEKVSDEILSKCNACYKSPCTNQGVCEPLPERQYQCRCTPGYHGQHCEFMIDACYGNPCRNSGTCKLLEEGRFNCECAPGYTGDRCEINIDDCLSHKCENNATCVDLIQAYECRCAPGFQGEFCQTKTPFCAGEYNPCRNGARCLDHFSHYTCECTPGFSGVNCTVNVDDCVNHMCQNGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGKESLLQQTTKA
cccEEEcccccEEEEccccccccccccccccccccccccccccccccccCEEcccccccEEEEcccccccccccccccccccccccccccccccccEEEEccccccccccccccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccccccccccEEEEcccccCEECccccccccccccccccccccccccccccccccccccccCEECcccccccccccccccccccccccccCEcccccccEEEEccccccccccccccccccccccccccEEECcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEECccccEEEccccccccccccccccccccccccccccccccccccEEcccccccEEEEcccccccccccccccccc
NGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGVEEFRTRYAGDCLIDAACPSGCSCDGTRVDCSQRGLKEIPKDIPLYTTELILNDNEIGKIKSDGLFGRLPNLIKLDLRRNQVTGIEDNAFEGENDQGCLGDNYCPPKCTCTVRVLFYDGRAGECYIAVELFSSRIRVSYYVGNYPVSTMYRDLSNNQIGFLSNFTFSPLSKLSQLILSYNKLQCIDRDALAGLKSLRIISLHGNDISMIPEGAFADLHAITHLAIGGNPLYCDCGLAWLSEWVKRDYVEPGIARCTEPASMRDKLLLTAPASSFQCKEKVSDEILSKCNACYKSPCTNQGVCEPLPERQYQCRCTPGYHGQHCEFMIDACYGNPCRNSGTCKLLEEGRFNCECAPGYTGDRCEINIDDCLSHKCENNATCVDLIQAYECRCAPGFQGEFCQTKTPFCAGEYNPCRNGARCLDHFSHYTCECTPGFSGVNCTVNVDDCVNHMCQNGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGKESLLQQ**K*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGVEEFRTRYAGDCLIDAACPSGCSCDGTRVDCSQRGLKEIPKDIPLYTTELILNDNEIGKIKSDGLFGRLPNLIKLDLRRNQVTGIEDNAFEGENDQGCLGDNYCPPKCTCTVRVLFYDGRAGECYIAVELFSSRIRVSYYVGNYPVSTMYRDLSNNQIGFLSNFTFSPLSKLSQLILSYNKLQCIDRDALAGLKSLRIISLHGNDISMIPEGAFADLHAITHLAIGGNPLYCDCGLAWLSEWVKRDYVEPGIARCTEPASMRDKLLLTAPASSFQCKEKVSDEILSKCNACYKSPCTNQGVCEPLPERQYQCRCTPGYHGQHCEFMIDACYGNPCRNSGTCKLLEEGRFNCECAPGYTGDRCEINIDDCLSHKCENNATCVDLIQAYECRCAPGFQGEFCQTKTPFCAGEYNPCRNGARCLDHFSHYTCECTPGFSGVNCTVNVDDCVNHMCQNGGTCVDGINDYTCKCEGDFVGKFCEIAPFVAMMYPQTSPCQHHDCKNGICFQPQGSNDYLCKCAPGYSGKESLLQQTTKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein slit A short-range repellent, controlling axon crossing of the midline and a long-range chemorepellent, controlling mesoderm migration and patterning away from the midline. May interact with extracellular matrix molecules. Repulsive ligand for the guidance receptor roundabout (robo) and prevents inappropriate midline crossing by Robo-expressing axons.confidentP24014

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0040012 [BP]regulation of locomotionprobableGO:0008150, GO:0065007, GO:0050789
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0021834 [BP]chemorepulsion involved in embryonic olfactory bulb interneuron precursor migrationprobableGO:0021537, GO:0032502, GO:0044707, GO:0021826, GO:0030154, GO:0048468, GO:0006928, GO:0021988, GO:0051674, GO:0021885, GO:0021889, GO:0007275, GO:0044699, GO:0007417, GO:0051179, GO:0042330, GO:0048869, GO:0021891, GO:0048513, GO:0021879, GO:0030900, GO:0016477, GO:0021872, GO:0021953, GO:0048666, GO:0021831, GO:0006935, GO:0030182, GO:0032501, GO:0009987, GO:0048731, GO:0044767, GO:0008150, GO:0021772, GO:0050919, GO:0042221, GO:0022008, GO:0022028, GO:0022029, GO:0040011, GO:0048699, GO:0007420, GO:0009605, GO:0048870, GO:0050896, GO:0048856, GO:0007399, GO:0021843, GO:0044763
GO:0048846 [BP]axon extension involved in axon guidanceprobableGO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051270 [BP]regulation of cellular component movementprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0071666 [CC]Slit-Robo signaling complexprobableGO:0005575, GO:0032991, GO:0032992
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 97-302
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 94-181,209-301
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 97-316
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 359-475
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 435-550
View the alignment between query and template
View the model in PyMOL
Template: 1NFU, chain B
Confidence level:very confident
Coverage over the Query: 561-599
View the alignment between query and template
View the model in PyMOL