Diaphorina citri psyllid: psy15410


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MTTIRKPIDEVARSHLVDFGKYCAEILPKYIEKVQITSGDELELLIIPEGVVPVLQFLKDHHTAQFVSLVDIAGMDVPSRPNRFEVD
cccccccccHHHHHHHHHHHHHHHHHcccHHHHEEEECccEEEEEEcccccHHHHHHHHccccccccEEcccEEEcccccccccccc
*TTIRKPIDEVARSHLVDFGKYCAEILPKYIEKVQITSGDELELLIIPEGVVPVLQFLKDHHTAQFVSLVDIAGMDVPSRPNRF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTIRKPIDEVARSHLVDFGKYCAEILPKYIEKVQITSGDELELLIIPEGVVPVLQFLKDHHTAQFVSLVDIAGMDVPSRPNRFEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO75489
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ9DCT2
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ0MQG8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003954 [MF]NADH dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MCR, chain A
Confidence level:confident
Coverage over the Query: 14-86
View the alignment between query and template
View the model in PyMOL